DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or85e

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster


Alignment Length:449 Identity:84/449 - (18%)
Similarity:155/449 - (34%) Gaps:127/449 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RAMKFIGWLPPKQGVLRYVYLTWTLMTFVWCT----TYLPLGFLGSYMTQIKSFSPGEFLTSLQV 86
            :.::.||.:.||                .:|:    |.|.||.|.: .|.:.....||    ||.
  Fly    53 KRLEMIGKVLPK----------------AYCSMVIFTSLHLGVLFT-KTTLDVLPTGE----LQA 96

  Fly    87 CINAYGSSVKVAIT-YSMLWRLIKAKNILDQLDLRCTAMEEREKIHLVVARSNHAFLIFTFV--Y 148
            ..:|...::....| |..::..::::.:|..::            |:.....:|:....|||  :
  Fly    97 ITDALTMTIIYFFTGYGTIYWCLRSRRLLAYME------------HMNREYRHHSLAGVTFVSSH 149

  Fly   149 CGYAGS-----TYLSSVLSGRPPW--------------QLYNPFIDWHDGTLKLWVASTLEYMVM 194
            ..:..|     .::.|.|.|...|              |.:.||.....||.....|:.|...:|
  Fly   150 AAFRMSRNFTVVWIMSCLLGVISWGVSPLMLGIRMLPLQCWYPFDALGPGTYTAVYATQLFGQIM 214

  Fly   195 SG----------AVLQDQLSDSYPLIYTLI--LRAHLDML-RERIRRLRS-DENLSEAESYEE-- 243
            .|          ..|...|...:.::|..:  |.||..:| .|.:..|.| .|.|...:|..|  
  Fly   215 VGMTFGFGGSLFVTLSLLLLGQFDVLYCSLKNLDAHTKLLGGESVNGLSSLQEELLLGDSKRELN 279

  Fly   244 -------------------------------LVKCVMDHKLILRYCAIIKPVIQGTIFTQFLLI- 276
                                           ||:|:..|:.||.....::     .:|:.:.|: 
  Fly   280 QYVLLQEHPTDLLRLSAGRKCPDQGNAFHNALVECIRLHRFILHCSQELE-----NLFSPYCLVK 339

  Fly   277 GLVLGFTLINVFFFSDIWTGIASFMFVITI----------LLQTFPFCYTCNLIMEDCESLTHAI 331
            .|.:.|.|..:.|     .|::....|:.|          :.:...|.|...|:.........|.
  Fly   340 SLQITFQLCLLVF-----VGVSGTREVLRIVNQLQYLGLTIFELLMFTYCGELLSRHSIRSGDAF 399

  Fly   332 FQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSVITITKQM 390
            ::..|...:...:..:|.||.|.::.:...||..:.:.::...||...|||.:|:.:::
  Fly   400 WRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVMDVNRLRSVITQAFSFLTLLQKL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 69/384 (18%)
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 62/350 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.