DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or85d

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster


Alignment Length:319 Identity:63/319 - (19%)
Similarity:125/319 - (39%) Gaps:58/319 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 RLIKAKNILDQLDLRCTAMEEREKI-HLVVARSN--------HAFLIFTF-----VY---CGY-A 152
            ||.:..:.|::|..:..|.:|...| |.:...|.        |..||:|:     ||   |.: .
  Fly   114 RLTQVVSRLEELHPQGLAQQEPYNIGHHLSGYSRYSKFYFGMHMVLIWTYNLYWAVYYLVCDFWL 178

  Fly   153 GSTYLSSVLSGRPPWQLYNPFIDWHDG--TLKLWVASTL-EYMVMSGAVLQDQLSDSYPLIYTLI 214
            |......:|    |:..:.|: ||..|  ...::::..: ....:||.:..|.|..:   :.||:
  Fly   179 GMRQFERML----PYYCWVPW-DWSTGYSYYFMYISQNIGGQACLSGQLAADMLMCA---LVTLV 235

  Fly   215 ------LRAHLDMLRERIRRLRSDENLSEAESYEELVKCVMDHKLILRYCAIIKPVIQGTIFTQF 273
                  |.||::.....|...:.|        .|.|...|..|:.::..|..|..:...::.:.|
  Fly   236 VMHFIRLSAHIESHVAGIGSFQHD--------LEFLQATVAYHQSLIHLCQDINEIFGVSLLSNF 292

  Fly   274 LLIGLVLGFTLINVFFFSDIWTGIASFMFVITILLQTFPFCYTCNLIMEDCESLTHAIFQSNWVD 338
            :....::.|....:...|.|...:...:|:...::|.|........:::..|.:..|::..:|..
  Fly   293 VSSSFIICFVGFQMTIGSKIDNLVMLVLFLFCAMVQVFMIATHAQRLVDASEQIGQAVYNHDWFR 357

  Fly   339 ASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFA-FSVITITKQMNIADKF 396
            |..||:..|:..::..|||              |.:....|. .|::|::..:.::.||
  Fly   358 ADLRYRKMLILIIKRAQQP--------------SRLKATMFLNISLVTVSDLLQLSYKF 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 59/302 (20%)
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 61/315 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465953
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.