DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or85b

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster


Alignment Length:418 Identity:79/418 - (18%)
Similarity:158/418 - (37%) Gaps:86/418 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RAMKFIGWLPPKQGVLRYV-----YLTWTLMTFVWCTTYLPLGFLGSY--MTQIKSFSPGEFLTS 83
            :.||:..:.....|:..|.     .:...:...|:.:..:.|.|:|.:  :....:|...:||.:
  Fly     3 KLMKYASFFYTAVGIRPYTNGEESKMNKLIFHIVFWSNVINLSFVGLFESIYVYSAFMDNKFLEA 67

  Fly    84 LQVCINAYGSSVKVAIT--YSMLWRLIKAKNILDQLD-------LRCTAMEEREKIHLVVARSNH 139
              |...:|...|.|.::  :.:.|:......::::|.       :|    |||..:.:.:...:.
  Fly    68 --VTALSYIGFVTVGMSKMFFIRWKKTAITELINELKEIYPNGLIR----EERYNLPMYLGTCSR 126

  Fly   140 AFLIFTFVYCGYAGSTYLSSVLSGRPPWQLYNPFIDWHDGTLKLW----------VASTLEYMVM 194
            ..||::.:|          |||.    | .:|.|.     .::.|          |...|.|::.
  Fly   127 ISLIYSLLY----------SVLI----W-TFNLFC-----VMEYWVYDKWLNIRVVGKQLPYLMY 171

  Fly   195 SGAVLQDQLSDSYPLIYT----------------LILRA-------HLDMLRERIRRLRSDENLS 236
            .....||..| .|||:::                ::|.|       |.|.|...:.|.....:..
  Fly   172 IPWKWQDNWS-YYPLLFSQNFAGYTSAAGQISTDVLLCAVATQLVMHFDFLSNSMERHELSGDWK 235

  Fly   237 EAESYEELVKCVMDHKLILRYCAIIKPVIQGTIFTQFLLIGLVL---GFTLINVFFFSDIWTGIA 298
            :...:  ||..|..|:.|||....:..:....:...|::...|:   ||.: .|....||  .:.
  Fly   236 KDSRF--LVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQM-TVGVPPDI--VVK 295

  Fly   299 SFMFVITILLQTFPFCYTCNLIMEDCESLTHAIFQSNWVDASRRYKTTLLYFLQNVQQPIVFIAG 363
            .|:|:::.:.|.:..|:...|:.:.....:.|.:...|..|..|||..|:..:.. .|.:.|:..
  Fly   296 LFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIAR-SQKVTFLKA 359

  Fly   364 GIF-QISMSSNISVAKFAFSVITITKQM 390
            .|| .|:.|:...:.:.::....:.:.|
  Fly   360 TIFLDITRSTMTDLLQISYKFFALLRTM 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 69/350 (20%)
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 69/346 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465951
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.