DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or85a

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster


Alignment Length:400 Identity:157/400 - (39%)
Similarity:253/400 - (63%) Gaps:4/400 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFELIRPAPLTEQKRSRDGCIYLYRAMKFIGW-LPPKQGVLRYVYLTWTLMTFVWCTTYLPLGF 64
            |:|:.|:...|....||||..|||.|::..:|| |||:.....::|..|||:..|....::|.|.
  Fly     1 MIFKYIQEPVLGSLFRSRDSLIYLNRSIDQMGWRLPPRTKPYWWLYYIWTLVVIVLVFIFIPYGL 65

  Fly    65 LGSYMTQIKSFSPGEFLTSLQVCINAYGSSVKVAITYSMLWRLIKAKNILDQLDLRCTAMEEREK 129
            :.:.:.:.|:|:..:..|.:||.:|...|.:|..|...|..|..:|:.::|.:|:|||.|||:.:
  Fly    66 IMTGIKEFKNFTTTDLFTYVQVPVNTNASIMKGIIVLFMRRRFSRAQKMMDAMDIRCTKMEEKVQ 130

  Fly   130 IHLVVARSNHAFLIFTFVYCGYAGSTYLSSVLSGRPPWQLYNPFIDWHDGTLKLWVASTLEYMVM 194
            :|...|..|...:|:..:|.||.......:::.|:.|:.||||.::..|   ..::|:.:|.:.|
  Fly   131 VHRAAALCNRVVVIYHCIYFGYLSMALTGALVIGKTPFCLYNPLVNPDD---HFYLATAIESVTM 192

  Fly   195 SGAVLQDQLSDSYPLIYTLILRAHLDMLRERIRRLRSDENLSEAESYEELVKCVMDHKLILRYCA 259
            :|.:|.:.:.|.||:||.::||.|:::|.|||:.||:|....:.:.|.|||:||.|||||:.|..
  Fly   193 AGIILANLILDVYPIIYVVVLRIHMELLSERIKTLRTDVEKGDDQHYAELVECVKDHKLIVEYGN 257

  Fly   260 IIKPVIQGTIFTQFLLIGLVLGFTLINVFFFSDIWTGIASFMFVITILLQTFPFCYTCNLIMEDC 324
            .::|:|..|:|.|.|.:||:||...:::.|::.:...:.|.::.|.||.|||||||.|..:..||
  Fly   258 TLRPMISATMFIQLLSVGLLLGLAAVSMQFYNTVMERVVSGVYTIAILSQTFPFCYVCEQLSSDC 322

  Fly   325 ESLTHAIFQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSVITITKQ 389
            ||||:.:|.|.|:.|.|||:||:|||:.||||.|:|.|||||.|.:::||.:|||||||:||..:
  Fly   323 ESLTNTLFHSKWIGAERRYRTTMLYFIHNVQQSILFTAGGIFPICLNTNIKMAKFAFSVVTIVNE 387

  Fly   390 MNIADKFKTD 399
            |::|:|.:.:
  Fly   388 MDLAEKLRRE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 122/304 (40%)
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 122/304 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468549
Domainoid 1 1.000 64 1.000 Domainoid score I17159
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I7489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D31412at7147
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.