DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or83c

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:430 Identity:85/430 - (19%)
Similarity:158/430 - (36%) Gaps:112/430 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RSRDGCIYLYRAMKFIG--WLPPKQGVLRYVYLTWT----LMTFVWCTTYLPL--------GFLG 66
            |.|:...|:......:|  :|.||   |::.|.|||    :..:...|.:..|        |...
  Fly    10 RFRELSKYINSLTNLLGVDFLSPK---LKFNYRTWTTIFAIANYTGFTVFTILNNGGDWRVGLKA 71

  Fly    67 SYMTQIKSFSPGEFLTSLQVCINAYGSSVKVAITYSMLWRLI-KAKNILDQLDLRCTAMEEREKI 130
            |.||.......|:|||.|              :.:..:.||: .:::|.|:.:.|      .:..
  Fly    72 SLMTGGLFHGLGKFLTCL--------------LKHQDMRRLVLYSQSIYDEYETR------GDSY 116

  Fly   131 HLVVARSNHAFLI---------FTFVYC----------GYAGS--TYLSSVLSGRPPWQLYNPFI 174
            |..: .||...|:         :.|.:|          .|.|:  |.:..::.|.|   |.|.: 
  Fly   117 HRTL-NSNIDRLLGIMKIIRNGYVFAFCLMELLPLAMLMYDGTRVTAMQYLIPGLP---LENNY- 176

  Fly   175 DWHDGTLKLWVASTLEYMVMSGAVLQDQL----SDSYPLIYTLILRAHLDMLRERIRRLRSDENL 235
                       ...:.||:.:..:|...:    .|.:..:....:....|||:.:::.|  ::.|
  Fly   177 -----------CYVVTYMIQTVTMLVQGVGFYSGDLFVFLGLTQILTFADMLQVKVKEL--NDAL 228

  Fly   236 SEAESYEELV-------------KCVMD----HKLILRYCAIIKPVIQGTIFTQFLLIGLVLGFT 283
            .:...|..||             :.::|    |:|...||..|..:....|.||.|.:.|.:..:
  Fly   229 EQKAEYRALVRVGASIDGAENRQRLLLDVIRWHQLFTDYCRAINALYYELIATQVLSMALAMMLS 293

  Fly   284 L-INVFFF---SDIWTGIASFMFVITILLQT-FPFCYTCNLIMEDCESLTHAIFQSNWVDASRRY 343
            . ||:..|   |.|:..::::...|..:|.| ..|.|         :.:..:|....|.:.|...
  Fly   294 FCINLSSFHMPSAIFFVVSAYSMSIYCILGTILEFAY---------DQVYESICNVTWYELSGEQ 349

  Fly   344 KTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSV 383
            :....:.|:..|.|......|:..:|:.:.:.:.|..:||
  Fly   350 RKLFGFLLRESQYPHNIQILGVMSLSVRTALQIVKLIYSV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 65/352 (18%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 68/364 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465514
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.