DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or71a

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster


Alignment Length:408 Identity:90/408 - (22%)
Similarity:169/408 - (41%) Gaps:48/408 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFELIRPAPLTEQKRSRDGCIYLYRAMKFIGWLPPKQGVLRYVYLTWTLMTFVWCTTYLPLGFL 65
            |.::.|||.      |...|.:..:|.     | |.|:.|....:..|.....     ::|..||
  Fly     1 MDYDRIRPV------RFLTGVLKWWRL-----W-PRKESVSTPDWTNWQAYAL-----HVPFTFL 48

  Fly    66 G---SYMTQIKSFSPGEFLTSLQVCINAYGSSVKVAITYSMLWRLIK-AKNIL------DQLDLR 120
            .   .::..|||.........|.:|:.......||.    .:|:... |:.||      |..:||
  Fly    49 FVLLLWLEAIKSRDIQHTADVLLICLTTTALGGKVI----NIWKYAHVAQGILSEWSTWDLFELR 109

  Fly   121 CTAMEEREKIHLVVARSNHAFLIFTFVYCGYAGSTYLSSV--LSGRPPWQLYNPFIDWHDGTLKL 183
              :.:|.:.......|.|..|:.:.....|......:..:  :..|.|:.::.|| ||....| .
  Fly   110 --SKQEVDMWRFEHRRFNRVFMFYCLCSAGVIPFIVIQPLFDIPNRLPFWMWTPF-DWQQPVL-F 170

  Fly   184 WVASTLEYMVMSGAVLQDQLSDSYPLIYTLILRAHLDMLRERIRRLRSDENLSEAESYEELVKCV 248
            |.|...:...:..|...:...|:......|.|...|.||.:|:.:|:.|:.    :..|:.::.:
  Fly   171 WYAFIYQATTIPIACACNVTMDAVNWYLMLHLSLCLRMLGQRLSKLQHDDK----DLREKFLELI 231

  Fly   249 MDHKLILRYCAIIKPVIQGTIFTQFLLIGLVLGFTLINVFF---FSDIWTGIASFM-FVITILLQ 309
            ..|:.:.:....|:..|..:.|||.|:..|::.||:.::..   ..|: .|.|:.| :::.:::|
  Fly   232 HLHQRLKQQALSIEIFISKSTFTQILVSSLIICFTIYSMQMSPVLQDL-PGFAAMMQYLVAMIMQ 295

  Fly   310 T-FPFCYTCNLIMEDCESLTHAIFQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSN 373
            . .|..|. |.:::....||.:::.|:|.|.:.|.:..:|.|:..:.:|:...|||.|.|.:...
  Fly   296 VMLPTIYG-NAVIDSANMLTDSMYNSDWPDMNCRMRRLVLMFMVYLNRPVTLKAGGFFHIGLPLF 359

  Fly   374 ISVAKFAFSVITITKQMN 391
            ......|:|::.:...||
  Fly   360 TKTMNQAYSLLALLLNMN 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 68/318 (21%)
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 68/312 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466085
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.