DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or67b

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:411 Identity:78/411 - (18%)
Similarity:156/411 - (37%) Gaps:78/411 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LPPKQGVLRYVYLTWTLMTFV-WCTTYLPLGF-LGSYMTQIKSFSPGEFLT-SLQV-CINAYGSS 94
            :.|::...:|..||..|:..| ....|..:.| :.:||...:::.....|| .|.| .:..:...
  Fly    34 IAPRKRSSKYCRLTRILVLIVNLSIIYSLVAFIMENYMISFETYVEAVLLTFQLSVGVVKMFHFQ 98

  Fly    95 VKVAITYSMLW-----RLIKAKNILDQLDLRCTAMEEREK-----IHLVVARS-----NHAFLIF 144
            .||.....:::     .::|:..:. ||||      .|:|     :.|::..:     ......|
  Fly    99 NKVESCSQLVFSTETGEVLKSLGLF-QLDL------PRKKELLSSVSLILLNNWMIIDRQVMFFF 156

  Fly   145 TFV------YCGYAGSTYLSSVLSGRPPWQ-LYNPFI-DWHDGTLKLWVASTLEYMVMS-----G 196
            ..|      ||             .||.:| :::.:| |.....:.|...:.:.|:.:.     .
  Fly   157 KIVCMPVLYYC-------------VRPYFQYIFDCYIKDKDTCEMTLTYPAIVPYLQLGNYEFPS 208

  Fly   197 AVLQDQLSDSYPL-----------IYTLILRAH---LDMLRERIRRLRSDENLSEAESYEELVKC 247
            .|::..|..|.||           ::.::.|..   :.:||..::...||..:.:.:..:.|..|
  Fly   209 YVIRFFLLQSGPLWCFFAVFGFNSLFVVLTRYESGLIKVLRFLVQNSTSDILVPKDQRVKYLQCC 273

  Fly   248 VMDHKLILRYCA-------IIKPVIQGTIFTQFLLIGLVLGFTLINVFFFSDIWTGIASFMFVIT 305
            |   :|..|..:       :.|.:|........:||.::| :.:..|.....:|.|:....|| |
  Fly   274 V---RLFARISSHHNQIENLFKYIILVQCSVSSILICMLL-YKISTVLEVGWVWMGMIMVYFV-T 333

  Fly   306 ILLQTFPFCYTCNLIMEDCESLTHAIFQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISM 370
            |.|:...:..:...:....|.|.|..:..:|.:.||.:|..:...|...::..|...||...:|.
  Fly   334 IALEITLYNVSAQKVESQSELLFHDWYNCSWYNESREFKFMIKMMLLFSRRTFVLSVGGFTSLSH 398

  Fly   371 SSNISVAKFAFSVITITKQMN 391
            ...:.|.:.:.:...:.:.||
  Fly   399 KFLVQVFRLSANFFLLLRNMN 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 66/355 (19%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 42/215 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.