DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or67a

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster


Alignment Length:397 Identity:81/397 - (20%)
Similarity:157/397 - (39%) Gaps:78/397 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YLYRAMKF---IGWLPPKQGVLRYVYLTWTLMTFVWCTTYLPLGFLGSYMTQIKSFSPGE-FLTS 83
            :|..|:||   :|..|.:.|..|.:   |..:.|......:...|.....|.:......| ||.|
  Fly    18 FLRLAVKFYNTLGIDPYETGRKRTI---WFQIYFALNMFNMVFSFYAEVATLVDRLRDNENFLES 79

  Fly    84 LQVCI-NAYGSSVKVAITYSMLWRLIKAK----NILDQLDLRC----TAMEERE--------KIH 131
               || .:|.|.|.:.:  |.:..::|.|    .::.||: .|    :|..:.|        :.|
  Fly    80 ---CILLSYVSFVVMGL--SKIGAVMKKKPKMTALVRQLE-TCFPSPSAKVQEEYAVKSWLKRCH 138

  Fly   132 LVVARSNHAFLIF--------TFVYCGYAGSTYLSSVLSGRPPWQLYNPFI-----DWHDGTL-- 181
            :........|:|.        .|:|       ::..||...|..:...||.     ::.|..|  
  Fly   139 IYTKGFGGLFMIMYFAHALIPLFIY-------FIQRVLLHYPDAKQIMPFYQLEPWEFRDSWLFY 196

  Fly   182 -KLWVASTLEYMVMSGAVLQDQLSDSYPLIYTLILRA--HLDMLRERIRRLRSDENLS---EAES 240
             ..:..|:..|....|::..|.      :|:.::|:.  |.:.|.:.:|..:...:.:   ..|.
  Fly   197 PSYFHQSSAGYTATCGSIAGDL------MIFAVVLQVIMHYERLAKVLREFKIQAHNAPNGAKED 255

  Fly   241 YEELVKCVMDHKLILRYCAIIKPVIQGTIFTQFL-------LIGLVLGFTLINVFFFSDIWTGIA 298
            ..:|...|.:|..|||...::..|....:...|:       |:|:.|...|...:|...:     
  Fly   256 IRKLQSLVANHIDILRLTDLMNEVFGIPLLLNFIASALLVCLVGVQLTIALSPEYFCKQM----- 315

  Fly   299 SFMFVITILLQTFPFCYTCNLIMEDCESLTHAIFQSNWVDASRRYKTTLLYFLQNVQQPIVFIAG 363
              :|:|::||:.:..|.....:::..|::.||.:..:|:.:.:|:|..|::.....|:|:...|.
  Fly   316 --LFLISVLLEVYLLCSFSQRLIDASENVGHAAYDMDWLGSDKRFKKILIFISMRSQKPVCLKAT 378

  Fly   364 GIFQISM 370
            .:..:||
  Fly   379 VVLDLSM 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 69/341 (20%)
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 68/337 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465954
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.