DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or63a

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:154 Identity:30/154 - (19%)
Similarity:61/154 - (39%) Gaps:5/154 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 EELVKCVMDHKLILRYCAIIKPVIQGTIFTQFLLI----GLVLGFTLINVFFFSDIWTGIASFMF 302
            |.|..|:..::.:..:...:....:...||||||.    ||.|....:.:...|.| |.|...|:
  Fly   266 EYLRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNWGLALFQMSVGLGNNSSI-TMIRMTMY 329

  Fly   303 VITILLQTFPFCYTCNLIMEDCESLTHAIFQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQ 367
            ::....|...:||.........|.:.:|.:|..|...||.::..:...|....:..........|
  Fly   330 LVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGESREFRHLIRMMLMRTNRGFRLDVSWFMQ 394

  Fly   368 ISMSSNISVAKFAFSVITITKQMN 391
            :|:.:.:::.:.:.....:.:.:|
  Fly   395 MSLPTLMAMVRTSGQYFLLLQNVN 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 29/142 (20%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 29/142 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465178
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.