DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or56a

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:446 Identity:82/446 - (18%)
Similarity:163/446 - (36%) Gaps:130/446 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RAMKFIGWLPPKQ------GVLRYVYLTWTLMTFVW--CTTYLPLGFLG---------SYMTQIK 73
            |..::.|::..|.      .::|...||    ..:|  |...|...|.|         ||.|.::
  Fly    24 RYFQWYGYVASKDQNRPLLSLIRCTILT----ASIWLSCALMLARVFRGYENLNDGATSYATAVQ 84

  Fly    74 SFSPGEFLTSLQVCINAYGSSVKV----AITYSMLWRLIKAKNILDQLDLRCTAMEEREKIHLVV 134
            .|:     .|:.: .|||....||    .:.:|.:      :|::.:.|.|        ::.|:|
  Fly    85 YFA-----VSIAM-FNAYVQRDKVISLLRVAHSDI------QNLMHEADNR--------EMELLV 129

  Fly   135 ARSNHAFLIFTFVY--------CGYAGSTYLSSVLSGRPPWQLYN------------------PF 173
            |...:...|...::        ..|:...|.|..|    |..::|                  ||
  Fly   130 ATQAYTRTITLLIWIPSVIAGLMAYSDCIYRSLFL----PKSVFNVPAVRRGEEHPILLFQLFPF 190

  Fly   174 IDWHD----GTLKLWVASTLEYMVMSGAVLQDQLSDSYPLIYTLI------LRAHLDMLRERIR- 227
            .:..|    |.|..|.|..|....:             ||.:|.|      :...|.:|.:|:. 
  Fly   191 GELCDNFVVGYLGPWYALGLGITAI-------------PLWHTFITCLMKYVNLKLQILNKRVEE 242

  Fly   228 -------------RLRSDE-NLSEAESYEELVKCVMDHKLILRYCAIIKPVIQGTIFTQFLLIGL 278
                         ||.:.| ...:.:.::|.||   :...|.::...::.:|...:...|::   
  Fly   243 MDITRLNSKLVIGRLTASELTFWQMQLFKEFVK---EQLRIRKFVQELQYLICVPVMADFII--- 301

  Fly   279 VLGFTLINVFFFSDIWTGIAS-----FMFVITILLQTFPFCY--TCNLIMEDCESLTHAIFQSNW 336
               |:::..|.|..:..|:.|     |||:...::....:.|  ...||:|..:.|:.|.|...|
  Fly   302 ---FSVLICFLFFALTVGVPSKMDYFFMFIYLFVMAGILWIYHWHATLIVECHDELSLAYFSCGW 363

  Fly   337 VDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSVITITKQMNI 392
            .:.....:..|::.:.:.|:|:...| .:..:::.:.|.:.:.|:|...:.:..::
  Fly   364 YNFEMPLQKMLVFMMMHAQRPMKMRA-LLVDLNLRTFIDIGRGAYSYFNLLRSSHL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 65/366 (18%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 55/307 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.