DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or43b

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster


Alignment Length:397 Identity:145/397 - (36%)
Similarity:225/397 - (56%) Gaps:7/397 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FELIRPAPLTEQKRSRDGCIYLYRAMKFIGW-LPPKQGVLRYVYLTWTLMTFVWCTTYLPLGFLG 66
            |:|:.|||::|..:|||...|:...::..|. |....|:.|.:   |.:.:|.:....||:.|..
  Fly     5 FKLVYPAPISEPIQSRDSNAYMMETLRNSGLNLKNDFGIGRKI---WRVFSFTYNMVILPVSFPI 66

  Fly    67 SYMTQIKSFSPGEFLTSLQVCINAYGSSVKVAITYSMLWRLIKAKNILDQLDLRCTAMEEREKIH 131
            :|:..:..|.|...|.|||:|:|.:..::|.........||..|....|:||..|....|:.|:.
  Fly    67 NYVIHLAEFPPELLLQSLQLCLNTWCFALKFFTLIVYTHRLELANKHFDELDKYCVKPAEKRKVR 131

  Fly   132 LVVARSNHAFLIFTFVYCGYAGSTYLSSVLSGRPPWQLYNPFIDWHDGTLKLWVASTLEYMVMSG 196
            .:||.....:|.|..||..||.||.|..:|..|.|:..|.|||:|.....::::.|.|||..:..
  Fly   132 DMVATITRLYLTFVVVYVLYATSTLLDGLLHHRVPYNTYYPFINWRVDRTQMYIQSFLEYFTVGY 196

  Fly   197 AVLQDQLSDSYPLIYTLILRAHLDMLRERIRRLRSDENLSEAE---SYEELVKCVMDHKLILRYC 258
            |:.....:||||:||...||.|:.:|::||..|....|...::   .::.||.|:..|:.:|.:|
  Fly   197 AIYVATATDSYPVIYVAALRTHILLLKDRIIYLGDPSNEGSSDPSYMFKSLVDCIKAHRTMLNFC 261

  Fly   259 AIIKPVIQGTIFTQFLLIGLVLGFTLINVFFFSDIWTGIASFMFVITILLQTFPFCYTCNLIMED 323
            ..|:|:|.||||.||::.|.:||..:||:..|:|..|.....::|:.:||||||.|:.||.|::|
  Fly   262 DAIQPIISGTIFAQFIICGSILGIIMINMVLFADQSTRFGIVIYVMAVLLQTFPLCFYCNAIVDD 326

  Fly   324 CESLTHAIFQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSVITITK 388
            |:.|.||:|.|.|....:||:.|::.|||.:|||:.|.|..||.|::::||:||||||:|..|..
  Fly   327 CKELAHALFHSAWWVQDKRYQRTVIQFLQKLQQPMTFTAMNIFNINLATNINVAKFAFTVYAIAS 391

  Fly   389 QMNIADK 395
            .||:..|
  Fly   392 GMNLDQK 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 117/307 (38%)
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 110/288 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468558
Domainoid 1 1.000 64 1.000 Domainoid score I17159
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I7489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D31412at7147
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.