DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or22a

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster


Alignment Length:395 Identity:164/395 - (41%)
Similarity:248/395 - (62%) Gaps:3/395 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FELIRPAPLTEQKRSRDGCIYLYRAMKFIGWLPPKQGVLRYVYLTWTLMTFVWCTTYLPLGFLGS 67
            |..|:..||:|:.:|||..|||.|.|...||..|:.......|..|.....:.....||:.....
  Fly     6 FPHIKEKPLSERVKSRDAFIYLDRVMWSFGWTEPENKRWILPYKLWLAFVNIVMLILLPISISIE 70

  Fly    68 YMTQIKSFSPGEFLTSLQVCINAYGSSVKVAITYSMLWRLIKAKNILDQLDLRCTAMEEREKIHL 132
            |:.:.|:||.||||:||::.:|.||||.|.|.|.....:..:||.:|||||.||.:.:||..:|.
  Fly    71 YLHRFKTFSAGEFLSSLEIGVNMYGSSFKCAFTLIGFKKRQEAKVLLDQLDKRCLSDKERSTVHR 135

  Fly   133 VVARSNHAFLIFTFVYCGYAGSTYLSSVLSGRPPWQLYNPFIDWHDGTLKLWVASTLEYMVMSGA 197
            .||..|...:::...|..:....:...:|..|..|::|.|:||..:   :.:::|..|..:|:.|
  Fly   136 YVAMGNFFDILYHIFYSTFVVMNFPYFLLERRHAWRMYFPYIDSDE---QFYISSIAECFLMTEA 197

  Fly   198 VLQDQLSDSYPLIYTLILRAHLDMLRERIRRLRSDENLSEAESYEELVKCVMDHKLILRYCAIIK 262
            :..|..:|..|||..|:.|.|:.:|::|:|.|||....:|.|..|||.:|:.||:|:|.|...::
  Fly   198 IYMDLCTDVCPLISMLMARCHISLLKQRLRNLRSKPGRTEDEYLEELTECIRDHRLLLDYVDALR 262

  Fly   263 PVIQGTIFTQFLLIGLVLGFTLINVFFFSDIWTGIASFMFVITILLQTFPFCYTCNLIMEDCESL 327
            ||..||||.||||||.|||.::||:.|||..|||:|:.:|:..:.::||||||.||:|::||:.:
  Fly   263 PVFSGTIFVQFLLIGTVLGLSMINLMFFSTFWTGVATCLFMFDVSMETFPFCYLCNMIIDDCQEM 327

  Fly   328 THAIFQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSVITITKQMNI 392
            ::.:|||:|..|.||||:||:|||.|:||||...|||:|.|||.:|:::.|.||||:|:.||.|:
  Fly   328 SNCLFQSDWTSADRRYKSTLVYFLHNLQQPITLTAGGVFPISMQTNLAMVKLAFSVVTVIKQFNL 392

  Fly   393 ADKFK 397
            |::|:
  Fly   393 AERFQ 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 131/304 (43%)
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 130/302 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468552
Domainoid 1 1.000 64 1.000 Domainoid score I17159
eggNOG 1 0.900 - - E1_2C9X1
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I7489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D31412at7147
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 1 1.000 - - otm50671
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.