DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or9a

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:411 Identity:96/411 - (23%)
Similarity:155/411 - (37%) Gaps:81/411 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IYLYRAMKFIGWLP------PKQGVLRYVYLTWTLMTFVWCTTYLPL------GFLGS--YMTQI 72
            |.:||.|....|.|      |           |  :|||   |..||      .||.:  |:||:
  Fly    21 ILVYRCMGIDLWSPTMANDRP-----------W--LTFV---TMGPLFLFMVPMFLAAHEYITQV 69

  Fly    73 KSFSP------GEFLTSLQVCINAYGSSVKVAITYSMLWRLIKAKNILDQLDLRCTAMEEREKIH 131
            ...|.      ...||.::..:..|.....|.:.|.:  |.|.||.|....|       .||.|.
  Fly    70 SLLSDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHI--RAILAKEIEVWPD-------AREIIE 125

  Fly   132 LVVARSNHAFLIFTFVYC-GYAG---------STYLSSVLSGRPPWQLYNPFIDWHDGTLKLWVA 186
              |...:...|..|:..| |.||         ...|||:.......:|.:..:..:|..:.::..
  Fly   126 --VENQSDQMLSLTYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYDLQVVMFYV 188

  Fly   187 STLEYMVMS--GAVLQDQLSDSYPLIYTLILRAHLDMLRERIRRLRSDENLSEAESYEELVKCVM 249
            .|..:.||:  .||......||....:|..:.|...:.:.|:..|.:   :...|..|.||:.::
  Fly   189 PTYLWNVMASYSAVTMALCVDSLLFFFTYNVCAIFKIAKHRMIHLPA---VGGKEELEGLVQVLL 250

  Fly   250 DHKLILRYCAIIKPVIQGTIFTQFLLIGL---VLGFTLINVF------FFSDIWTGIASFMFVIT 305
            .|:..|:....|....:..||.||.|..|   .:||.:.::|      :|         ..||.:
  Fly   251 LHQKGLQIADHIADKYRPLIFLQFFLSALQICFIGFQVADLFPNPQSLYF---------IAFVGS 306

  Fly   306 ILLQTFPFCYTCNLIMEDCESLTHAIFQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISM 370
            :|:..|.:......|........:.::::||.|.|...|..||......|:|.. :.|..|:.||
  Fly   307 LLIALFIYSKCGENIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRPCQ-MKGYFFEASM 370

  Fly   371 SSNISVAKFAFSVITITKQMN 391
            ::..::.:.|.|.|.:.:..|
  Fly   371 ATFSTIVRSAVSYIMMLRSFN 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 73/331 (22%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 74/336 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465590
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.