DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or65c

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster


Alignment Length:315 Identity:59/315 - (18%)
Similarity:106/315 - (33%) Gaps:116/315 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LYRAMKFIGW----LPPKQGVLRYVYLTWTLMTFVWCTTYLPLGFLGSYMTQIKSFSPGEFLTSL 84
            |:.|..| .|    :.|......|::.||.:|.|:   |:|                        
  Fly   182 LHAAFPF-QWHEKSIHPISHAFIYLFQTWNVMYFL---TWL------------------------ 218

  Fly    85 QVCINAYGSSVKVAITYSMLWRLIKAKNILDQLDLRCTAMEE-----------REKIHLVVARSN 138
             |||.....|:.|.||:::....::    |..|..||...|:           .:||..::..:|
  Fly   219 -VCIEGLSVSIYVEITFAIEVLCLE----LRHLHQRCHGYEQLRLETNRLVQFHQKIVHILDHTN 278

  Fly   139 HAFLIFTFVYCGYAGSTYLSSVLSGRPPWQLYNPFIDWHDGTLKLWVASTLEYMVMSGAVLQDQL 203
            ..|                                    .|||.:.:.  :.:.::|.:||:...
  Fly   279 KVF------------------------------------HGTLIMQMG--VNFFLVSLSVLEAME 305

  Fly   204 SDSYP------LIYTLILRAHLDMLRERIRRLRSDENLSEAESYEELVKCVMDHKLILR-YCAII 261
            :...|      .:..|:...||.|. .....|.|.::|:.:|:..|....:...|.:.| .|.||
  Fly   306 ARKDPKVVAQFAVLMLLALGHLSMW-SYFGDLLSQKSLTISEAAYEAYDPIKGSKDVYRDLCLII 369

  Fly   262 K----PVI-QGTIFTQFLLIGLVLGFTLINVFFFSDIWTGIASFMF-VITILLQT 310
            :    |:| :.:.|..|..|.                ::.|.:..: ::|.||:|
  Fly   370 RRGQEPLIMRASPFPSFNFIN----------------YSAILNQCYGILTFLLKT 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 47/259 (18%)
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 55/304 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465214
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.