DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or65a

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_729161.1 Gene:Or65a / 318011 FlyBaseID:FBgn0041625 Length:417 Species:Drosophila melanogaster


Alignment Length:427 Identity:78/427 - (18%)
Similarity:153/427 - (35%) Gaps:106/427 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FIGWLPPK--QGVLRYVYLTWTLMTFVWCTTYLPLGFLGSYMTQIKSFSP----GEFLTSLQVCI 88
            |..|...|  |...|::...||..         .|..||.||...:...|    .::..|:|:..
  Fly    21 FESWAVFKAPQAKSRHIIAYWTRD---------QLKALGFYMNSEQRRLPRIVAWQYFVSIQLAT 76

  Fly    89 NA----YGSSVKVA------------ITYSML-WRLIKAKNILDQLDLRCTAME----------- 125
            ..    ||.|..:.            ||...: :||:.......:||:...|:|           
  Fly    77 ALASLFYGISESIGDIVNLGRDLVFIITIIFICFRLVFFAQYAGELDVIIDALEDIYHWSIKGPA 141

  Fly   126 -----EREKIHLVVARSNHAFLIFTFVYCGYAGSTYLSSVLSGRPPWQLYN---PF-IDW----H 177
                 |.:::|         ||:|..:...:.....|..::....|:.:.:   || :.|    |
  Fly   142 TKEVQETKRLH---------FLLFMALIITWFSFLILFMLIKISTPFWIESQTLPFHVSWPFQLH 197

  Fly   178 DGTLKLWVASTLEYMVMSGAVLQDQLSDSYPLIYTLI---------------LRAHLDMLRERIR 227
            |.:     ...:.|:::.       :|.|..::|.||               |.:.|.:|...:|
  Fly   198 DPS-----KHPIAYIIIF-------VSQSTTMLYFLIWLGVVENMGVSLFFELTSALRVLCIELR 250

  Fly   228 RLR----SDENLSEAESYEELVKCVMDHKLILRYCAIIKPVIQGTIFTQFLLIGLVLGFTLINVF 288
            .|:    .||::    .|.||.:....|:.|:........:..|....|.|:..|::..:|..|.
  Fly   251 NLQELCLGDEDM----LYRELCRMTKFHQQIILLTDRCNHIFNGAFIMQMLINFLLVSLSLFEVL 311

  Fly   289 FFSDIWTGIASFMFVITILLQTFPFCYTC-NLIMEDCESLTHAIFQSNWVD---ASRRYKTTLLY 349
            ...........:|.::.:.|....|.... ::..::.|.:..|::::  .|   .|:.......:
  Fly   312 AAKKNPQVAVEYMIIMLMTLGHLSFWSKFGDMFSKESEQVALAVYEA--YDPNVGSKSIHRQFCF 374

  Fly   350 FLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSVITI 386
            |:|..|:|::..|......::.:.:.:.|..:|::||
  Fly   375 FIQRAQKPLIMKASPFPPFNLENYMFILKQCYSILTI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 63/372 (17%)
Or65aNP_729161.1 7tm_6 145..406 CDD:251636 49/287 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465250
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.