DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or69a

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:405 Identity:68/405 - (16%)
Similarity:144/405 - (35%) Gaps:90/405 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AMKFIGWLPPKQGVLRYVYLTWTLMTFVWCTTYLPLGFLGSYMTQIKSFSPGEFLTSLQVCINAY 91
            |.:.|.||    |.:..||..      :.|..|   |:.|...|:    .|..:|..|....:..
  Fly    37 AKRIIFWL----GAVNLVYHN------IGCVMY---GYFGDGRTK----DPIAYLAELASVASML 84

  Fly    92 GSSVKVAITYSMLWRLIKAKNILDQLDLRCTAMEEREKIHLVVARSNHAFLIFTFVYCGYAGSTY 156
            |.::...:.   ||:::..|...:.|      :.|.|::..::....:....:...|..:..:|:
  Fly    85 GFTIVGTLN---LWKMLSLKTHFENL------LNEFEELFQLIKHRAYRIHHYQEKYTRHIRNTF 140

  Fly   157 L---SSVLSGRPPWQLYNPFIDWHDGTLKLWV------ASTLEYMVMSGAVLQDQLSDSYPLIYT 212
            :   |:|:       .||..      .:.|.:      :..|.|.:.|......|:..|.|..:.
  Fly   141 IFHTSAVV-------YYNSL------PILLMIREHFSNSQQLGYRIQSNTWYPWQVQGSIPGFFA 192

  Fly   213 LI---------------------------LRAHLDMLRERIRRLRSDENLSEAESYEELVKCVMD 250
            .:                           |..|.|.|..::..:    :.....:.::|...::.
  Fly   193 AVACQIFSCQTNMCVNMFIQFLINFFGIQLEIHFDGLARQLETI----DARNPHAKDQLKYLIVY 253

  Fly   251 HKLILRYCAIIKPVIQGTIFTQFLLIGLVLGFTLINVFF-FS----DIWTGIASFMFVITILLQT 310
            |..:|.   :...|.:...||  .||.|.:.. :.|.|. ||    |..|.:...:.::..:...
  Fly   254 HTKLLN---LADRVNRSFNFT--FLISLSVSM-ISNCFLAFSMTMFDFGTSLKHLLGLLLFITYN 312

  Fly   311 FPFCYTCNLIMEDCESLTHAIFQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNIS 375
            |..|.:...::.....:..|.|.:||.:....|:..||..:....:|.::....:..:|:::.::
  Fly   313 FSMCRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMA 377

  Fly   376 VAKFAFSVITITKQM 390
            ..||::.:.|..:.:
  Fly   378 TLKFSYQMFTCVRSL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 55/345 (16%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 54/340 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465950
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.