DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42b and Or19b

DIOPT Version :9

Sequence 1:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_728315.1 Gene:Or19b / 260693 FlyBaseID:FBgn0062565 Length:387 Species:Drosophila melanogaster


Alignment Length:384 Identity:100/384 - (26%)
Similarity:170/384 - (44%) Gaps:36/384 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 YRAMKFIGWLPPKQGVLRYVYLTWTLMTFVWCTTYLPLGFLGSYMTQIKSFSPGEFLTSLQVCIN 89
            :|..:.:|..||  |...:....:|..:.||..|:....::...:..::|.|...|..||.|.:.
  Fly    16 WRIFRIMGIHPP--GKRTFWGRHYTAYSMVWNVTFHICIWVSFSVNLLQSNSLETFCESLCVTMP 78

  Fly    90 AYGSSVKVAITYSMLWRLIKAKNILDQLDLRCTAMEEREKIHLVVARSNHAFLIFTFVYCGYA-- 152
            .....:|:.....|...:|.:..:|..||.|....:||:   :::|....|..||..::.|.|  
  Fly    79 HTLYMLKLINVRRMRGEMISSHWLLRLLDKRLGCADERQ---IIMAGIERAEFIFRTIFRGLACT 140

  Fly   153 ---GSTYLSSVLSGRPPWQLYNPFIDWHDGTLKLWVASTLEYM---------VMSGAVLQDQLSD 205
               |..|:|   :...|..:|..:|.|:      |..||..|:         :|:.|.|...|| 
  Fly   141 VVLGIIYIS---ASSEPTLMYPTWIPWN------WKDSTSAYLATAMLHTTALMANATLVLNLS- 195

  Fly   206 SYPLIYTLILRAHLDMLRERIRRLRSDENLSEAESYEELVKCVMDHKLILRYCAIIKPVIQGTIF 270
            |||..|.:::..|...|..|:.:|.....|........||..:.||::|||....::..:..|.|
  Fly   196 SYPGTYLILVSVHTKALALRVSKLGYGAPLPAVRMQAILVGYIHDHQIILRLFKSLERSLSMTCF 260

  Fly   271 TQFLLIGLVLGFTLINVFFFSDIWTGIASFM---FVITIL-LQTFPFCYTCNLIMEDCESLTHAI 331
            .||...... ..|:.....|.::  ||..||   |::.|| .:|...|||..|..::.|||..|:
  Fly   261 LQFFSTACA-QCTICYFLLFGNV--GIMRFMNMLFLLVILTTETLLLCYTAELPCKEGESLLTAV 322

  Fly   332 FQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSVITITKQM 390
            :..||:..|..::..||..|...|.|::.::|.|..|||.:...:.|.|::::|:..::
  Fly   323 YSCNWLSQSVNFRRLLLLMLARCQIPMILVSGVIVPISMKTFTVMIKGAYTMLTLLNEI 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 88/322 (27%)
Or19bNP_728315.1 7tm_6 65..372 CDD:251636 88/322 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468659
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.