DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42a and Or83c

DIOPT Version :9

Sequence 1:NP_523622.2 Gene:Or42a / 35514 FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:425 Identity:95/425 - (22%)
Similarity:162/425 - (38%) Gaps:76/425 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SKDSP-VRSRDATLYLLRCVFLMGV--RKPPAKFFVAYVLWS--FAL-NFCS-TFYQPI------ 65
            :.:|| .|.|:.:.|:.....|:||  ..|..||  .|..|:  ||: |:.. |.:..:      
  Fly     3 TSESPSSRFRELSKYINSLTNLLGVDFLSPKLKF--NYRTWTTIFAIANYTGFTVFTILNNGGDW 65

  Fly    66 ------GFLTGYISHLSEFSPGEFLTSLQVAFNAWSCSTKVLIVWALV----KRFDEANNLLDEM 120
                  ..:||.:.|    ..|:|||          |..|...:..||    ..:||.....|..
  Fly    66 RVGLKASLMTGGLFH----GLGKFLT----------CLLKHQDMRRLVLYSQSIYDEYETRGDSY 116

  Fly   121 DRRITDPGERLQIHRAVSLSNRIFFFF------MAVYMVYATN-TFLSAIFIGRPPYQNYYPFLD 178
            .|.:....:||.....:..:..:|.|.      :|:.|...|. |.:..:..|.|...||...:.
  Fly   117 HRTLNSNIDRLLGIMKIIRNGYVFAFCLMELLPLAMLMYDGTRVTAMQYLIPGLPLENNYCYVVT 181

  Fly   179 WRSSTLHLALQ-AGL---EYFAMAG----ACFQDVC-VDCYPVNFVLVLRAHMSIFAERLRRLGT 234
            :...|:.:.:| .|.   :.|...|    ..|.|:. |....:|..|..:|..    ..|.|:|.
  Fly   182 YMIQTVTMLVQGVGFYSGDLFVFLGLTQILTFADMLQVKVKELNDALEQKAEY----RALVRVGA 242

  Fly   235 YPYESQEQKYERLVQCIQDHKVILRFVDCLRPVISGTIFVQFLVVGLVLGFTL-INIVLFANLGS 298
             ..:..|.:...|:..|:.|::...:...:..:....|..|.|.:.|.:..:. ||:..| ::.|
  Fly   243 -SIDGAENRQRLLLDVIRWHQLFTDYCRAINALYYELIATQVLSMALAMMLSFCINLSSF-HMPS 305

  Fly   299 AIAALSFMAAVLLETTPFCILCNYLTEDCYKLADALFQS----NWIDEEKRYQKTLMYFLQKLQQ 359
            ||    |........:.:|||...| |..|   |.:::|    .|.:.....:|...:.|::.|.
  Fly   306 AI----FFVVSAYSMSIYCILGTIL-EFAY---DQVYESICNVTWYELSGEQRKLFGFLLRESQY 362

  Fly   360 PITFMAMNVFPISVGTNISVTKFSFSVFTLVKQMN 394
            |.....:.|..:||.|.:.:.|..:||..::  ||
  Fly   363 PHNIQILGVMSLSVRTALQIVKLIYSVSMMM--MN 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 71/329 (22%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 74/345 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465511
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.