DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42a and Or83a

DIOPT Version :9

Sequence 1:NP_523622.2 Gene:Or42a / 35514 FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:453 Identity:95/453 - (20%)
Similarity:165/453 - (36%) Gaps:146/453 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ATLYLLRCVFLMGVRKPPAKFFV------AYVLWSFALNFCSTFYQPIGFLTGYISHLSEFSPGE 82
            |.||:  |...:...:....|||      ...||:.|:......::| |.|...:|::::    |
  Fly    68 AGLYI--CTIYINYGQGDLDFFVNCLIQTIIYLWTIAMKLYFRRFRP-GLLNTILSNIND----E 125

  Fly    83 FLTSLQVAFN--AWSCSTKVLIVWALVKRFDEANNLLDEMDRRITDPGERLQIHRAVSLSNRIFF 145
            :.|...|.|:  ..:.|.::..:|  :|.:                                   
  Fly   126 YETRSAVGFSFVTMAGSYRMSKLW--IKTY----------------------------------- 153

  Fly   146 FFMAVYMVYATNTFLSAIFIG----RPPYQNYYPFLDWRSSTLH---LALQAGLEY-----FAMA 198
                ||..|....|..|:.|.    ..|...:||| |:....::   ..|||..:.     ||.:
  Fly   154 ----VYCCYIGTIFWLALPIAYRDRSLPLACWYPF-DYTQPGVYEVVFLLQAMGQIQVAASFASS 213

  Fly   199 GACFQDVCV---DCYPVNF----------VLVLRAHMSIFAERLRRL-----------GTYPYES 239
            ......:||   ..|.|.|          .:::.|:|:    .|.:|           |.|.|..
  Fly   214 SGLHMVLCVLISGQYDVLFCSLKNVLASSYVLMGANMT----ELNQLQAEQSAADVEPGQYAYSV 274

  Fly   240 QEQK--YERL----------------VQCIQDHKVILRFVDCLRPVISGTIFVQFLVVGLVLGFT 286
            :|:.  .|.|                |:|||.|:.|   |..|:.:.|....:.|:.:|.|.  .
  Fly   275 EEETPLQELLKVGSSMDFSSAFRLSFVRCIQHHRYI---VAALKKIESFYSPIWFVKIGEVT--F 334

  Fly   287 LINIVLFANLGSAIAALSFM---------AAVLLETTPFCILCNYLTEDCYKLADALFQSNWIDE 342
            |:.:|.|.:..|. ||.|||         ..||.|....|...:.:.::..:..:||::|.|...
  Fly   335 LMCLVAFVSTKST-AANSFMRMVSLGQYLLLVLYELFIICYFADIVFQNSQRCGEALWRSPWQRH 398

  Fly   343 EKRYQKTLMYFLQKLQQPITFMAMNVFPISVG--TNISVTKF------SFSVFTLVKQMNISE 397
            .|..:...|:|:...::.        |.::.|  :|::|.:|      :||..||:::|:..|
  Fly   399 LKDVRSDYMFFMLNSRRQ--------FQLTAGKISNLNVDRFRGTITTAFSFLTLLQKMDARE 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 75/377 (20%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 67/303 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.