DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42a and Or71a

DIOPT Version :9

Sequence 1:NP_523622.2 Gene:Or42a / 35514 FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster


Alignment Length:406 Identity:90/406 - (22%)
Similarity:166/406 - (40%) Gaps:65/406 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PVRSRDATLYLLRCVFLMGV----RKPPAKFFVAYVLW----SFALNFCSTFYQPI-----GFLT 69
            |||            ||.||    |..|.|..|:...|    ::||:...||...:     ...:
  Fly     8 PVR------------FLTGVLKWWRLWPRKESVSTPDWTNWQAYALHVPFTFLFVLLLWLEAIKS 60

  Fly    70 GYISHLSEFSPGEFLTSLQVAFNAWSCSTKVLIVWALVKRFDEANNLLDE------MDRRITDPG 128
            ..|.|.::.        |.:.....:...||:.:|   |....|..:|.|      .:.|.....
  Fly    61 RDIQHTADV--------LLICLTTTALGGKVINIW---KYAHVAQGILSEWSTWDLFELRSKQEV 114

  Fly   129 ERLQI-HRAVSLSNRIFFFFMAVYMVYATNTFLSAIF--IGRPPYQNYYPFLDWRSSTLH---LA 187
            :..:. ||..   ||:|.|:............:..:|  ..|.|:..:.|| ||:...|.   ..
  Fly   115 DMWRFEHRRF---NRVFMFYCLCSAGVIPFIVIQPLFDIPNRLPFWMWTPF-DWQQPVLFWYAFI 175

  Fly   188 LQAGLEYFAMAGACFQDVCVDCYPVNFVLVLRAHMSIFAERL-RRLGTYPYESQEQKYERLVQCI 251
            .||    ..:..||..:|.:|.  ||:.|:|  |:|:....| :||....::.::.: |:.::.|
  Fly   176 YQA----TTIPIACACNVTMDA--VNWYLML--HLSLCLRMLGQRLSKLQHDDKDLR-EKFLELI 231

  Fly   252 QDHKVILRFVDCLRPVISGTIFVQFLVVGLVLGFTLINIVL---FANLGSAIAALSFMAAVLLET 313
            ..|:.:.:....:...||.:.|.|.||..|::.||:.::.:   ..:|....|.:.::.|::::.
  Fly   232 HLHQRLKQQALSIEIFISKSTFTQILVSSLIICFTIYSMQMSPVLQDLPGFAAMMQYLVAMIMQV 296

  Fly   314 TPFCILCNYLTEDCYKLADALFQSNWIDEEKRYQKTLMYFLQKLQQPITFMAMNVFPISVGTNIS 378
            ....|..|.:.:....|.|:::.|:|.|...|.::.::.|:..|.:|:|..|...|.|.:.....
  Fly   297 MLPTIYGNAVIDSANMLTDSMYNSDWPDMNCRMRRLVLMFMVYLNRPVTLKAGGFFHIGLPLFTK 361

  Fly   379 VTKFSFSVFTLVKQMN 394
            ....::|:..|:..||
  Fly   362 TMNQAYSLLALLLNMN 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 68/320 (21%)
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 68/322 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.