DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42a and Or63a

DIOPT Version :9

Sequence 1:NP_523622.2 Gene:Or42a / 35514 FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:445 Identity:85/445 - (19%)
Similarity:167/445 - (37%) Gaps:87/445 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LYTQSKDSPVRSRD--ATLYLLRCVFLMGVR-KPPAKFFVAYVLWSFALNFCS--TFYQPIGFLT 69
            :|:..:.:.::.|:  :...::|..:.:|.. ..|::......:|:..|:..|  :.|.....|.
  Fly     1 MYSPEEAAELKRRNYRSIREMIRLSYTVGFNLLDPSRCGQVLRIWTIVLSVSSLASLYGHWQMLA 65

  Fly    70 GYISHLSEFSPGE-------FLTSLQVAFNAWSCSTKVLIVWALVKRFDEANNLLD--EMDRRIT 125
            .||..:...  ||       ||||:.   ..|........::.|::: ...:.||.  |:..|::
  Fly    66 RYIHDIPRI--GETAGTALQFLTSIA---KMWYFLFAHRQIYELLRK-ARCHELLQKCELFERMS 124

  Fly   126 DPGERLQIHRAV-SLSNRIFFFFMAVYMVY-------ATNTFLSAIFIG------RP-------- 168
            |.....:|.:.| |..||.:.......::|       .||.|:::..|.      :|        
  Fly   125 DLPVIKEIRQQVESTMNRYWASTRRQILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDIML 189

  Fly   169 PYQNYYPFLDWRSSTL---HLALQAGLEYFAMAGACFQDVCVDCYPVNF---VLVLRAHMSIFAE 227
            |..:.||  .|....|   :..:|..||      .|...:|..| .|:|   .:||..|......
  Fly   190 PLPSLYP--AWEHKGLEFPYYHIQMYLE------TCSLYICGMC-AVSFDGVFIVLCLHSVGLMR 245

  Fly   228 RLRRL---GTYPYESQEQKYERLVQCIQDHKVILRFV----DCLRPVISGTIFVQFLVVGLVLGF 285
            .|.::   .|......:::.|.|..||..::.:..|.    :|.|.:    .|.|||:.....|.
  Fly   246 SLNQMVEQATSELVPPDRRVEYLRCCIYQYQRVANFATEVNNCFRHI----TFTQFLLSLFNWGL 306

  Fly   286 TLINIVLFANLGSAIAALSFMAAVLLETTPFCILCNY-LTEDCY----------KLADALFQSNW 339
            .|..:.:.....|:|        .::..|.:.:...| :...||          ::|:|.:|..|
  Fly   307 ALFQMSVGLGNNSSI--------TMIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRW 363

  Fly   340 IDEEKRYQKTLMYFLQKLQQPITFMAMNVFPISVGTNISVTKFSFSVFTLVKQMN 394
            ..|.:.::..:...|.:..:...........:|:.|.:::.:.|...|.|::.:|
  Fly   364 YGESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQNVN 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 69/359 (19%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 68/356 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.