DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42a and Or56a

DIOPT Version :9

Sequence 1:NP_523622.2 Gene:Or42a / 35514 FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:472 Identity:87/472 - (18%)
Similarity:170/472 - (36%) Gaps:161/472 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWFPTLYTQSKDSPVRSRDATLYLLRCVFLMGVRKPPAKFFVAYVLWSFALNFCSTF--YQPIG- 66
            :|:..:.::.::.|:      |.|:||..|           .|.:..|.||.....|  |:.:. 
  Fly    27 QWYGYVASKDQNRPL------LSLIRCTIL-----------TASIWLSCALMLARVFRGYENLND 74

  Fly    67 FLTGYISHLSEFSPGEFLTSLQVA-FNAWSCSTKVLIVWALVKRFDEANNLLDEMDRRITDPGER 130
            ..|.|.:.:..|       ::.:| |||:....||:.:  |.....:..||:.|.|.|..:....
  Fly    75 GATSYATAVQYF-------AVSIAMFNAYVQRDKVISL--LRVAHSDIQNLMHEADNREMELLVA 130

  Fly   131 LQ-------------------------IHRAVSLSNRIF-----------------FF------- 146
            .|                         |:|::.|...:|                 .|       
  Fly   131 TQAYTRTITLLIWIPSVIAGLMAYSDCIYRSLFLPKSVFNVPAVRRGEEHPILLFQLFPFGELCD 195

  Fly   147 -FMAVYM--VYATNTFLSAIFIGRPPYQNYYPFLDWRSSTLHLALQAGLEYFAMAGACFQDVCVD 208
             |:..|:  .||....::||.:       ::.|:......::|.||       :.....::  :|
  Fly   196 NFVVGYLGPWYALGLGITAIPL-------WHTFITCLMKYVNLKLQ-------ILNKRVEE--MD 244

  Fly   209 CYPVNFVLVLRA---------HMSIFAERLRRLGTYPYESQEQKYERLVQCIQDHKVILRFVDCL 264
            ...:|..||:..         .|.:|.|         :..::.:..:.||.:|       ::.|:
  Fly   245 ITRLNSKLVIGRLTASELTFWQMQLFKE---------FVKEQLRIRKFVQELQ-------YLICV 293

  Fly   265 RPVISG----TIFVQFLVVGLVLG------FTLINIVLFANLGSAIAALSFMAAVLLETTPFCIL 319
             ||::.    ::.:.||...|.:|      :..:.|.||...|                    ||
  Fly   294 -PVMADFIIFSVLICFLFFALTVGVPSKMDYFFMFIYLFVMAG--------------------IL 337

  Fly   320 CNY-----LTEDCY-KLADALFQSNWIDEEKRYQKTLMYFLQKLQQPITFMAMNVFPISVGTNIS 378
            ..|     |..:|: :|:.|.|...|.:.|...||.|::.:...|:|:...|:.| .:::.|.|.
  Fly   338 WIYHWHATLIVECHDELSLAYFSCGWYNFEMPLQKMLVFMMMHAQRPMKMRALLV-DLNLRTFID 401

  Fly   379 VTKFSFSVFTLVKQMNI 395
            :.:.::|.|.|::..::
  Fly   402 IGRGAYSYFNLLRSSHL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 68/382 (18%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 56/334 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.