DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42a and Or49b

DIOPT Version :9

Sequence 1:NP_523622.2 Gene:Or42a / 35514 FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster


Alignment Length:336 Identity:56/336 - (16%)
Similarity:128/336 - (38%) Gaps:66/336 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 VLIVW------------------ALVKRFDEAN----NLLDEMDRRITDPGERLQIHRAVSLSNR 142
            :|::|                  ||:::..||.    ||.|.....|.|     |:::...|..|
  Fly    62 MLVLWINTVLRAYLLLADHDRYLALIQKLTEAYYDLLNLNDSYISEILD-----QVNKVGKLMAR 121

  Fly   143 IFFFF-------MAVYMVYATNTFLSAIFIGRPPYQNYYPFLDWRSSTLHLALQAGLEYFAM--- 197
            ...||       ..:|.:.::...|        |:.:..|.|:...|          .|:.|   
  Fly   122 GNLFFGMLTSMGFGLYPLSSSERVL--------PFGSKIPGLNEYES----------PYYEMWYI 168

  Fly   198 -------AGACFQDVCVDCYPVNFVLVLRAHMSIFAERLRRLG-TYPYESQEQK--YERLVQCIQ 252
                   .|.|.. :......|..::...........|||::. .:||..::.:  .|.::.||:
  Fly   169 FQMLITPMGCCMY-IPYTSLIVGLIMFGIVRCKALQHRLRQVALKHPYGDRDPRELREEIIACIR 232

  Fly   253 DHKVILRFVDCLRPVISGTIFVQFLVVGLVLGFTLINIVLFANLGSAIAALSFMAAVLLETTPFC 317
            ..:.|:.::|.:..:.:.....:.:....:|...|..:::.:.....|....::..:|.:.....
  Fly   233 YQQSIIEYMDHINELTTMMFLFELMAFSALLCALLFMLIIVSGTSQLIIVCMYINMILAQILALY 297

  Fly   318 ILCNYLTEDCYKLADALFQSNWIDEEKRYQKTLMYFLQKLQQPITFMAMNVFPISVGTNISVTKF 382
            ...|.|.|....:|.|.:::.|...:...:|.:::.:.:.|:|...:..|:.||::....::...
  Fly   298 WYANELREQNLAVATAAYETEWFTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNT 362

  Fly   383 SFSVFTLVKQM 393
            :::.||::|::
  Fly   363 TYTFFTVLKRV 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 53/325 (16%)
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 53/325 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465775
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.