DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42a and Or35a

DIOPT Version :9

Sequence 1:NP_523622.2 Gene:Or42a / 35514 FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster


Alignment Length:384 Identity:72/384 - (18%)
Similarity:134/384 - (34%) Gaps:116/384 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 FLTGYISHLSEFSPGEFLTSLQVAFNAWSCSTKVLIVWALVKRFDE---ANNLLD-----EMDRR 123
            ||||..::|             :...|...|..:|:.:..:::|.|   ||..:|     ||.|:
  Fly    78 FLTGMPTYL-------------ILVEAQFRSLHILLHFEKLQKFLEIFYANIYIDPRKEPEMFRK 129

  Fly   124 ITDPGERLQIHRAVSLSNRIFFFFMAVYMVYATNTFLSAI-----FIGRPPYQNYYPFLDWRSST 183
            :..   ::.|:|.||.      .:.||..:|......|.|     |:    |...:||   .|..
  Fly   130 VDG---KMIINRLVSA------MYGAVISLYLIAPVFSIINQSKDFL----YSMIFPF---DSDP 178

  Fly   184 LHLALQ-------AGLEYFAMAGACFQDVCVDCYPV----NFVLVLRAHMSIFAERLRRLGTYPY 237
            |::.:.       .|:....|   .|.:..:.|..:    ...::|:..:.:..|::......|:
  Fly   179 LYIFVPLLLTNVWVGIVIDTM---MFGETNLLCELIVHLNGSYMLLKRDLQLAIEKILVARDRPH 240

  Fly   238 ESQEQKYERLVQCIQDHKVILRFVDCLRPVISGTIFVQFLVVGLVLGFTLINIVLFANLGSAIAA 302
            .:::.|              :.....||..::...|.|    .|...:|:...::||.....:.|
  Fly   241 MAKQLK--------------VLITKTLRKNVALNQFGQ----QLEAQYTVRVFIMFAFAAGLLCA 287

  Fly   303 LSFMAAVLLETTPFCILCNYL------------------------TEDCYKLADALFQSNW---- 339
            |||.|    .|.|   :.||:                        |.|  .|:...:.::|    
  Fly   288 LSFKA----YTNP---MANYIYAIWFGAKTVELLSLGQIGSDLAFTTD--SLSTMYYLTHWEQIL 343

  Fly   340 -----IDEEKRYQKTLMYFLQKLQQPITFMAMNVFPISVGTNISVTKFSFSVFTLVKQM 393
                 ..|..|..|.:...::...:|.....:..|.:|:...:.:.:.|||.||.:..|
  Fly   344 QYSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTSM 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 61/361 (17%)
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 66/373 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465919
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.