DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42a and Or82a

DIOPT Version :9

Sequence 1:NP_523622.2 Gene:Or42a / 35514 FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:375 Identity:78/375 - (20%)
Similarity:145/375 - (38%) Gaps:74/375 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ISHLSEFSPGEFLTSLQ------VAFN------AWSC----STKVLIV-------------WALV 107
            :.|:|...   |:.|.|      ||:|      ..:|    .|.:|.|             |.::
  Fly    31 LKHISSLI---FVISAQYPLISYVAYNRNDMEKVTACLSVVFTNMLTVIKISTFLANRKDFWEMI 92

  Fly   108 KRFDEANNLLDEMDRRITDPGERLQIHRAVSLSNRIFFFFMAVYMVYATNTFL-----SAIFIG- 166
            .||   ..:.::....|....|.|..   |:.:|::..|....|.|....|.|     ..:.|| 
  Fly    93 HRF---RKMHEQSASHIPRYREGLDY---VAEANKLASFLGRAYCVSCGLTGLYFMLGPIVKIGV 151

  Fly   167 ----------RPPYQNYYPFLDWRSSTLHL----ALQAGLEYFAMAGACFQDVCVDCYPVNFVLV 217
                      ..|....:||.|..|....:    .:...:...|.|.|      ||...::|.:.
  Fly   152 CRWHGTTCDKELPMPMKFPFNDLESPGYEVCFLYTVLVTVVVVAYASA------VDGLFISFAIN 210

  Fly   218 LRAHMSIFAERLRRLGTYPYESQEQKYE-RLVQCIQDHKVILRFVDCLRPVISGTIFVQFLVVGL 281
            ||||   |....|::..:.:.|.|...: ||...::.|.::|.....||.:.:.|:..||::..|
  Fly   211 LRAH---FQTLQRQIENWEFPSSEPDTQIRLKSIVEYHVLLLSLSRKLRSIYTPTVMGQFVITSL 272

  Fly   282 VLGFTLINIVLFANLGSAIAAL---SFMAAVLLETTPFCILCNYLTEDCYKLADALFQSNWIDEE 343
            .:|..:..:|  .|:.|.:..|   ||..:::|:...:|.....:..:..::..|:..|||....
  Fly   273 QVGVIIYQLV--TNMDSVMDLLLYASFFGSIMLQLFIYCYGGEIIKAESLQVDTAVRLSNWHLAS 335

  Fly   344 KRYQKTLMYFLQKLQQPITFMAMNVFPISVGTNISVTKFSFSVFTLVKQM 393
            .:.:.:|...:.:.|:.:...| ..|..|:...:.:.:.:.|:.||:|.:
  Fly   336 PKTRTSLSLIILQSQKEVLIRA-GFFVASLANFVGICRTALSLITLIKSI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 72/357 (20%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 65/326 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465605
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.