DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or42a and Or69a

DIOPT Version :9

Sequence 1:NP_523622.2 Gene:Or42a / 35514 FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:378 Identity:81/378 - (21%)
Similarity:145/378 - (38%) Gaps:59/378 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLWSFALNFCSTFYQPIG-FLTGYISHLSEFSPGEFLTSL-QVAFNAWSCSTKVLIVWALVKRFD 111
            :.|..|:|.   .|..|| .:.||........|..:|..| .||..........|.:|.::....
  Fly    41 IFWLGAVNL---VYHNIGCVMYGYFGDGRTKDPIAYLAELASVASMLGFTIVGTLNLWKMLSLKT 102

  Fly   112 EANNLLDEMDRRITDPGERLQI--HRAVSLSNRIFFFFMAVYMVYATNTFL---SAIFIGRPPYQ 171
            ...|||:|.:       |..|:  |||..:.:     :...|..:..|||:   ||:.     |.
  Fly   103 HFENLLNEFE-------ELFQLIKHRAYRIHH-----YQEKYTRHIRNTFIFHTSAVV-----YY 150

  Fly   172 NYYPFLDW------RSSTLHLALQAGLEY-----------FAMAG----ACFQDVCVDC---YPV 212
            |..|.|..      .|..|...:|:...|           ||...    :|..::||:.   :.:
  Fly   151 NSLPILLMIREHFSNSQQLGYRIQSNTWYPWQVQGSIPGFFAAVACQIFSCQTNMCVNMFIQFLI 215

  Fly   213 NFV-LVLRAHMSIFAERLRRL-GTYPYESQEQKYERLVQCIQDHKVILRFVDCLRPVISGTIFVQ 275
            ||. :.|..|....|.:|..: ...|:...:.||     .|..|..:|...|.:....:.|..:.
  Fly   216 NFFGIQLEIHFDGLARQLETIDARNPHAKDQLKY-----LIVYHTKLLNLADRVNRSFNFTFLIS 275

  Fly   276 FLVVGLVLGFTLINIVLFANLGSAIAALSFMAAVLLETTPFCILCNYLTEDCYKLADALFQSNWI 340
            ..|..:...|...::.:| :.|:::..|..:...:......|....:|.....|:..|.|.:||.
  Fly   276 LSVSMISNCFLAFSMTMF-DFGTSLKHLLGLLLFITYNFSMCRSGTHLILTSGKVLPAAFYNNWY 339

  Fly   341 DEEKRYQKTLMYFLQKLQQPITFMAMNVFPISVGTNISVTKFSFSVFTLVKQM 393
            :.:..|::.|:..:.:..:|..:....:.|:|:.|.::..|||:.:||.|:.:
  Fly   340 EGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQMFTCVRSL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 69/336 (21%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 68/331 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465911
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.