DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT41F and SLC30A3

DIOPT Version :9

Sequence 1:NP_610185.1 Gene:ZnT41F / 35513 FlyBaseID:FBgn0025693 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_005264604.1 Gene:SLC30A3 / 7781 HGNCID:11014 Length:412 Species:Homo sapiens


Alignment Length:122 Identity:44/122 - (36%)
Similarity:61/122 - (50%) Gaps:12/122 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GDCGDSARNQSSETE-----------FDMQRECCNHQPGFRANSKSKSAQEAKYKIMLAVALCCV 142
            |..|.|.|.:|..||           .:|....|:..| ......:.....|:.::..|.|:|.|
Human    22 GGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDP-LPPPGLTPERLHARRQLYAACAVCFV 85

  Fly   143 FMIIEFLGGYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRPPDERMSFGYKRFE 199
            ||..|.:|||:|.|||||||||||.:|..|.:..|.::|:..||....|:||:.|.|
Human    86 FMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHRSE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT41FNP_610185.1 CDF 142..495 CDD:273544 30/58 (52%)
Cation_efflux 142..416 CDD:279834 30/58 (52%)
SLC30A3XP_005264604.1 Cation_efflux 85..>142 CDD:279834 29/56 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1230
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53838
OrthoDB 1 1.010 - - D351752at33208
OrthoFinder 1 1.000 - - FOG0000470
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.