DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT41F and Slc30a6

DIOPT Version :9

Sequence 1:NP_610185.1 Gene:ZnT41F / 35513 FlyBaseID:FBgn0025693 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001264208.1 Gene:Slc30a6 / 298786 RGDID:1309250 Length:460 Species:Rattus norvegicus


Alignment Length:361 Identity:63/361 - (17%)
Similarity:131/361 - (36%) Gaps:82/361 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 SAQEAKYKIML--AVALCCVFMIIEFLGGYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRPP 187
            :|....:||:|  |:.:.|...::.:...  ..|:|:.........|..|.:..|::.|:..|.|
  Rat    26 AADRRSWKILLFGAINVLCTGFLLMWCSS--TNSIALTAYTYLTIFDLFSLITCLISYWVMMRRP 88

  Fly   188 DERMSFGYKRFEVIGALASI----LGIWFVTTLLVVVAIERIFSQDFELNADMMMLISGIGIVIN 248
            ....|||::|.||:...||.    ||..|:    :..:.||...|. |::...:::.:.:.:..|
  Rat    89 SAAYSFGFERLEVLAVFASTVLAQLGALFI----LKESAERFLEQP-EIHTGRLLVGTFVALSFN 148

  Fly   249 IVMMFVLHGSWFVNGNGHGHSHSHSHSHSHSHGNGHEPNDSLSQTRSNSNFLTTIGSQSASTADE 313
            :..|..:....|                                         ...|::|||:..
  Rat   149 LFTMLSIRNKPF-----------------------------------------AYVSEAASTSWL 172

  Fly   314 EDSIRKEINSNEHKIVITNGKKPTLTGTSNMELAHEDKNLNLRAAMIHVIGDLVQSIGVFLAAVL 378
            :          ||...::......:.|.|::.|...:.         .|:.||..::.:.:..:|
  Rat   173 Q----------EHVADLSRSLCGIIPGLSSIFLPRMNP---------FVLIDLAGALALCITYML 218

  Fly   379 IKVCPGAKY--ADPLCTLIFSIIVIMTTLRLFRESLGIIVNAVPQNL--NMRTLHLELGSIEGVR 439
            |::   ..|  .|....:..:::...|...:...|..:::...|.::  .:..|..|:.:::||.
  Rat   219 IEI---NNYFAVDTASAIAIALMTFGTMYPMSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVL 280

  Fly   440 SLHHLNVWQQTSQQRVLMVHLVTDSRADGNEVLQAA 475
            .:.:.:.|..........||:  ..|.|.||.:..|
  Rat   281 EVRNEHFWTLGFGSLAGSVHV--RIRRDANEQMVLA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT41FNP_610185.1 CDF 142..495 CDD:273544 57/342 (17%)
Cation_efflux 142..416 CDD:279834 44/279 (16%)
Slc30a6NP_001264208.1 Cation_efflux 43..255 CDD:279834 45/281 (16%)
CzcD 55..331 CDD:224151 57/330 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.