DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT41F and toc-1

DIOPT Version :9

Sequence 1:NP_610185.1 Gene:ZnT41F / 35513 FlyBaseID:FBgn0025693 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001367624.1 Gene:toc-1 / 175728 WormBaseID:WBGene00006590 Length:446 Species:Caenorhabditis elegans


Alignment Length:245 Identity:55/245 - (22%)
Similarity:86/245 - (35%) Gaps:91/245 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 DMQRECCNHQPGF------RANSKSKSA----------QEAKYKIMLAVALCC------VFMIIE 147
            |:....|...||.      |.||....|          :..|:....|..:||      ||..:.
 Worm   196 DLSHAVCWVIPGLSRLLLPRINSMVLLALTTTGLNLLCEHFKHDFAWADPVCCLLLSVAVFSTMY 260

  Fly   148 FLGGYVAGSLAIMTDAAHLASD---CI---SFVIGLVAIWIGGRPPDERMSFGYKRFEVIGALAS 206
            .|..| .|.:.:.|...||.:.   ||   |.:.|::.:..|             ||..:. ..|
 Worm   261 PLSTY-TGMILLQTTPPHLINQIDRCISEASHIDGVLELKSG-------------RFWQLD-FNS 310

  Fly   207 ILGIWFVTTLLVVVAIERIFSQDFELNADMMMLISGI-----GIVINIVMMFVLHGSW------- 259
            ::|       .|.|.:.|        :||...:::.:     .::..:.:..|...:|       
 Worm   311 LVG-------TVDVRVRR--------DADEQNVLAHVTEKFSSVITVLTVQVVKDAAWSAGEQVP 360

  Fly   260 FVNG------------NGHGHSHSHS---HSHSH------SHGNGHEPND 288
            :.||            |||||||.|:   |||.|      |||:.|:.|:
 Worm   361 YSNGHIHKSEGNHSHDNGHGHSHDHNDHGHSHGHDDHGHDSHGHSHDHNE 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT41FNP_610185.1 CDF 142..495 CDD:273544 43/186 (23%)
Cation_efflux 142..416 CDD:279834 43/186 (23%)
toc-1NP_001367624.1 Cation_efflux 45..271 CDD:396224 17/75 (23%)
ureE <378..441 CDD:237323 16/33 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.