DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT41F and SLC30A8

DIOPT Version :9

Sequence 1:NP_610185.1 Gene:ZnT41F / 35513 FlyBaseID:FBgn0025693 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_776250.2 Gene:SLC30A8 / 169026 HGNCID:20303 Length:369 Species:Homo sapiens


Alignment Length:450 Identity:133/450 - (29%)
Similarity:220/450 - (48%) Gaps:104/450 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DYQDRYYSVNNNSVNREVVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSSETEFDMQRECCNHQ 114
            ::.:|.|.||:.:......|:.|  |.:.::     |:..|  ...|.:..|.|......|    
Human     2 EFLERTYLVNDKAAKMYAFTLES--VELQQK-----PVNKD--QCPRERPEELESGGMYHC---- 53

  Fly   115 PGFRANSK--SKSAQE---AKYKIMLAVALCCVFMIIEFLGGYVAGSLAIMTDAAHLASDCISFV 174
               .:.||  .|.|.|   ||:|:..|.|:|.:|||.|.:||::|||||::||||||..|..||:
Human    54 ---HSGSKPTEKGANEYAYAKWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLIDLTSFL 115

  Fly   175 IGLVAIWIGGRPPDERMSFGYKRFEVIGALASILGIWFVTTLLVVVAIERIFSQDFELNADMMML 239
            :.|.::|:..:||.:|::||:.|.|::|||.|||.||.||.:||.:|.||:...|:::.|.:|::
Human   116 LSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTGVLVYLACERLLYPDYQIQATVMII 180

  Fly   240 ISGIGIVINIVMMFVLHGSWFVNGNGHGHSHSHSHSHSHSHGNGHEPNDSLSQTRSNSNFLTTIG 304
            :|...:..|||:..|||....      ||:|                                  
Human   181 VSSCAVAANIVLTVVLHQRCL------GHNH---------------------------------- 205

  Fly   305 SQSASTADEEDSIRKEINSNEHKIVITNGKKPTLTGTSNMELAHEDKNLNLRAAMIHVIGDLVQS 369
                          ||:.:                            |.::|||.:|.:|||.||
Human   206 --------------KEVQA----------------------------NASVRAAFVHALGDLFQS 228

  Fly   370 IGVFLAAVLIKVCPGAKYADPLCTLIFSIIVIMTTLRLFRESLGIIVNAVPQNLNMRTLHLELGS 434
            |.|.::|::|...|..|.|||:||.||||:|:.:|:.:.::...:::..||::||...:...:.:
Human   229 ISVLISALIIYFKPEYKIADPICTFIFSILVLASTITILKDFSILLMEGVPKSLNYSGVKELILA 293

  Fly   435 IEGVRSLHHLNVWQQTSQQRVLMVHLVTDSRADGNEVLQAATALVSSPRYNIKHSTIQLE 494
            ::||.|:|.|::|..|..|.:|..|:.|.:..| ::|::...|...|..:.:...|||:|
Human   294 VDGVLSVHSLHIWSLTMNQVILSAHVATAASRD-SQVVRREIAKALSKSFTMHSLTIQME 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT41FNP_610185.1 CDF 142..495 CDD:273544 108/352 (31%)
Cation_efflux 142..416 CDD:279834 86/273 (32%)
SLC30A8NP_776250.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..52 5/22 (23%)
CDF 83..353 CDD:273544 108/352 (31%)
Cation_efflux 83..274 CDD:279834 86/272 (32%)
HXXXXX[HY]NH-motif 197..205 3/13 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1230
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53838
OrthoDB 1 1.010 - - D351752at33208
OrthoFinder 1 1.000 - - FOG0000470
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.