DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT41F and SLC30A7

DIOPT Version :9

Sequence 1:NP_610185.1 Gene:ZnT41F / 35513 FlyBaseID:FBgn0025693 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001138356.1 Gene:SLC30A7 / 148867 HGNCID:19306 Length:376 Species:Homo sapiens


Alignment Length:401 Identity:95/401 - (23%)
Similarity:173/401 - (43%) Gaps:99/401 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 FRANSKSKSAQEAKYKIMLAVALCCVFMIIEFLGGYVAGSLAIMTDAAHLASDCISFVIGLVAIW 181
            ||:....|:::...:.:.|.::    |..:|.|.|..:..|.:::|:.|:..|..:.:.||.|..
Human    26 FRSILSDKTSRNLFFFLCLNLS----FAFVELLYGIWSNCLGLISDSFHMFFDSTAILAGLAASV 86

  Fly   182 IGGRPPDERMSFGYKRFEVIGALASILGIWFVTTLLVVVAIERIFSQDFELNADMMMLISGIGIV 246
            |.....::..|:||.|.||:....:.|.:.|....:....:||..:.. :::.:.::|:|.:|.|
Human    87 ISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAFFIFSEGVERALAPP-DVHHERLLLVSILGFV 150

  Fly   247 INIVMMFVL-HGS-WFVNGNGHGHSHS----------------HS--------HSHSHSHGNGH- 284
            :|::.:||. ||. ...:|:|||||||                ||        |||.|:||:|| 
Human   151 VNLIGIFVFKHGGHGHSHGSGHGHSHSLFNGALDQAHGHVDHCHSHEVKHGAAHSHDHAHGHGHF 215

  Fly   285 --EPNDSLSQTRSNSNFLTTIGSQSASTADEEDSIRKEINSNEHKIVITNGKKPTLTGTSNMELA 347
              ....||.:|                                             ||.|..   
Human   216 HSHDGPSLKET---------------------------------------------TGPSRQ--- 232

  Fly   348 HEDKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVCPGAKYADPLCTLIFSIIVIMTTLRLFRESL 412
                  .|:...:|::.|.:.||||..:|::::.. |...|||:|:::.:|:::::.:.|.|||:
Human   233 ------ILQGVFLHILADTLGSIGVIASAIMMQNF-GLMIADPICSILIAILIVVSVIPLLRESV 290

  Fly   413 GIIVNAVPQNL--NMRTLHLELGSIEGVRSLHHLNVWQQTSQQRVLMVHLVTDSRADGNEVLQAA 475
            ||::...|..|  ::...:..:..::||.||...:.|...|...|..:.|:....||...:|   
Human   291 GILMQRTPPLLENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWIL--- 352

  Fly   476 TALVSSPRYNI 486
                 |..:||
Human   353 -----SQTHNI 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT41FNP_610185.1 CDF 142..495 CDD:273544 91/376 (24%)
Cation_efflux 142..416 CDD:279834 75/302 (25%)
SLC30A7NP_001138356.1 CzcD 31..374 CDD:224151 93/396 (23%)
Cation_efflux 48..294 CDD:279834 75/301 (25%)
His-rich loop 161..218 20/56 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..226 12/31 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.