DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ap and HESX1

DIOPT Version :9

Sequence 1:NP_724428.1 Gene:ap / 35509 FlyBaseID:FBgn0267978 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001362987.1 Gene:HESX1 / 8820 HGNCID:4877 Length:185 Species:Homo sapiens


Alignment Length:142 Identity:40/142 - (28%)
Similarity:62/142 - (43%) Gaps:34/142 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 PTGIFVPA--SHVINGLPQPARQKGRPRKRKPKDIEAFTAN--IDLNTEYVDFGRGSHLSSSSRT 367
            |:||..|:  .|.:            |.:|..|....|:|:  :.|..|.          |..|.
Human    66 PSGISFPSVVDHPM------------PEERASKYENYFSASERLSLKREL----------SWYRG 108

  Fly   368 KRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLSQKTGLPKRVLQVWFQNARAKWRR-------- 424
            :|.||:|..:|:..:::.|.:|..|.....:.|:||..|.:..:|:||||.|||.:|        
Human   109 RRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFL 173

  Fly   425 MMMKQDGSGLLE 436
            |..|...:.|||
Human   174 MAKKNFNTNLLE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
apNP_724428.1 LIM1_Lhx2_Lhx9 148..201 CDD:188755
LIM2_Lhx2_Lhx9 206..264 CDD:188763
Homeobox 371..424 CDD:395001 19/52 (37%)
HESX1NP_001362987.1 Homeobox 111..165 CDD:365835 19/53 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.