DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ap and HB21

DIOPT Version :9

Sequence 1:NP_724428.1 Gene:ap / 35509 FlyBaseID:FBgn0267978 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_179445.1 Gene:HB21 / 816370 AraportID:AT2G18550 Length:220 Species:Arabidopsis thaliana


Alignment Length:145 Identity:35/145 - (24%)
Similarity:61/145 - (42%) Gaps:24/145 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 IFVPASHVINGLPQPARQKGRPRKRKPKDIEAFTANIDLNTEYVDFGRGSHLSSSSRTKRMRTSF 374
            ::.|......|..:|.|:    ||||.|.:             |....|.:..:....||   ..
plant    21 VYTPLVPQQGGEAKPTRR----RKRKSKSV-------------VVAEEGENEGNGWFRKR---KL 65

  Fly   375 KHHQLRTMKSYFAINHNPDAKDLKQLSQKTGLPKRVLQVWFQNARAKWRRMMMKQDGSGLLEKGE 439
            ...|:|.::..|..:|..:::...:|:.:.||..|.:.|||||.||:|:...::.:.:.|....|
plant    66 SDEQVRMLEISFEDDHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNKRVEDEYTKLKNAYE 130

  Fly   440 GAL----DLDSISVH 450
            ..:    .|||..:|
plant   131 TTVVEKCRLDSEVIH 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
apNP_724428.1 LIM1_Lhx2_Lhx9 148..201 CDD:188755
LIM2_Lhx2_Lhx9 206..264 CDD:188763
Homeobox 371..424 CDD:395001 16/52 (31%)
HB21NP_179445.1 HOX 61..114 CDD:197696 17/55 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.