DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ap and lhx2a

DIOPT Version :9

Sequence 1:NP_724428.1 Gene:ap / 35509 FlyBaseID:FBgn0267978 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_017208320.1 Gene:lhx2a / 795283 ZFINID:ZDB-GENE-091118-109 Length:328 Species:Danio rerio


Alignment Length:341 Identity:146/341 - (42%)
Similarity:193/341 - (56%) Gaps:53/341 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 ESTSDSKITRNLDDCSGCGRQIQDRFYLSAVEKRWHASCLQCYACRQPLERESSCYSRDGNIYCK 198
            ||.||:.:      |:|||..|.|||||.|.|:|||..||:|.||:..||.|.:|:|:.|:||||
Zfish     5 ESGSDAPV------CAGCGALISDRFYLLAAERRWHERCLKCSACQTDLESELTCFSKHGDIYCK 63

  Fly   199 NDYYS-FFGTRRCSRCLASISSNELVMRARNLVFHVNCFCCTVCHTPLTKGDQYGIIDALIYCRT 262
            .|||| .|.::||:||...||:.|:|||||:||:|::||.|..||..|..||.||:.:..:|||.
Zfish    64 EDYYSRRFSSQRCARCHLGISATEIVMRARDLVYHLSCFSCATCHKVLLTGDHYGMKETSVYCRA 128

  Fly   263 HYSIAREGDTASSSMSATYPYSAQFGSPHNDSSSPHSDPSRSIVPTGIFVPASHVINGLPQPARQ 327
            |.......|...|.||:           ...:|..|:....|.|                    .
Zfish   129 HIQRECHADLYYSDMSS-----------RETNSESHTYDEESPV--------------------H 162

  Fly   328 KGRPRKRK---PKDIEAFTANI-DLNTEYVDFGRGSHLSSSSRTKRMRTSFKHHQLRTMKSYFAI 388
            :.|.|:||   ..|..|::::: ||..:.      |...|..::|||||||||||||:|:|:|..
Zfish   163 RARVRRRKNNSTADHIAYSSDVSDLGVDL------SERVSCQKSKRMRTSFKHHQLRSMQSFFTH 221

  Fly   389 NHNPDAKDLKQLSQKTGLPKRVLQVWFQNARAKWRRMMMKQDGSGLLEKGEGALDLDSISVHSPT 453
            ||||||||||:|:|||||.||||||||||||||:||..:.|:..|:....:.: .|.|.||.||.
Zfish   222 NHNPDAKDLKELAQKTGLTKRVLQVWFQNARAKFRRNCLYQESIGVDNVSDNS-TLTSPSVPSPE 285

  Fly   454 ----SFILGGPNSTPP 465
                |.....|:.|.|
Zfish   286 LCHGSMSPSSPSGTSP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
apNP_724428.1 LIM1_Lhx2_Lhx9 148..201 CDD:188755 30/52 (58%)
LIM2_Lhx2_Lhx9 206..264 CDD:188763 28/57 (49%)
Homeobox 371..424 CDD:395001 43/52 (83%)
lhx2aXP_017208320.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8129
eggNOG 1 0.900 - - E33208_3BD2S
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 297 1.000 Inparanoid score I2706
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1174930at2759
OrthoFinder 1 1.000 - - FOG0002416
OrthoInspector 1 1.000 - - otm25706
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1607
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.