DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ap and LHX9

DIOPT Version :9

Sequence 1:NP_724428.1 Gene:ap / 35509 FlyBaseID:FBgn0267978 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_011508083.2 Gene:LHX9 / 56956 HGNCID:14222 Length:403 Species:Homo sapiens


Alignment Length:376 Identity:160/376 - (42%)
Similarity:212/376 - (56%) Gaps:73/376 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 RSRTDCTEVSDETTSGISFKTEPFG-PPSSPESTSDSKITRNLDDCSGCGRQIQDRFYLSAVEKR 167
            ||:|:.     ....|........| ||.|||..:         .|:|||.:|.||:||.||:|:
Human    46 RSKTEA-----RLAKGAQLNGRDAGMPPLSPEKPA---------LCAGCGGKISDRYYLLAVDKQ 96

  Fly   168 WHASCLQCYACRQPLERESSCYSRDGNIYCKNDYYSFFGTRRCSRCLASISSNELVMRARNLVFH 232
            ||..||:|..|:..||.|.:|:::||:||||.|||..|..:||:||...||::|:|||||:.|:|
Human    97 WHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYH 161

  Fly   233 VNCFCCTVCHTPLTKGDQYGIIDALIYCRTHYSIAREGDTASSSMSATYPYSAQFGSPHNDSSSP 297
            ::||.|:.|:..||.||.:|:.|:|:|||.|:....:|:         ||....:......|.  
Human   162 LSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGE---------YPPQLSYTELAAKSG-- 215

  Fly   298 HSDPSRSIVPTGIFVPASHVINGLPQPARQKGRPRKRKPKDIEAFTANIDLNTEYVDFGRG---- 358
                       |:.:|   ..||  ....|||||||||         :..|..:.|::..|    
Human   216 -----------GLALP---YFNG--TGTVQKGRPRKRK---------SPALGVDIVNYNSGCNEN 255

  Fly   359 --SHLS-------SSSRTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLSQKTGLPKRVLQVW 414
              .||.       .|.:||||||||||||||||||||||||||||||||||:|||||.|||||||
Human   256 EADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVW 320

  Fly   415 FQNARAKWRRMMMKQDGSGLLEKGEGALDLDSISVHSPTSFILGGPNSTPP 465
            |||||||:||.:::|:..| ::|.:|.      |:.:|.|...|.  .|||
Human   321 FQNARAKFRRNLLRQENGG-VDKADGT------SLPAPPSADSGA--LTPP 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
apNP_724428.1 LIM1_Lhx2_Lhx9 148..201 CDD:188755 28/52 (54%)
LIM2_Lhx2_Lhx9 206..264 CDD:188763 28/57 (49%)
Homeobox 371..424 CDD:395001 49/52 (94%)
LHX9XP_011508083.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6077
eggNOG 1 0.900 - - E33208_3BD2S
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 294 1.000 Inparanoid score I2768
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1174930at2759
OrthoFinder 1 1.000 - - FOG0002416
OrthoInspector 1 1.000 - - otm40827
orthoMCL 1 0.900 - - OOG6_105440
Panther 1 1.100 - - LDO PTHR24208
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3033
SonicParanoid 1 1.000 - - X1607
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.