DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ap and ftz

DIOPT Version :10

Sequence 1:NP_724428.1 Gene:ap / 35509 FlyBaseID:FBgn0267978 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:209 Identity:47/209 - (22%)
Similarity:73/209 - (34%) Gaps:50/209 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 TASSSMSATY-----PYSAQFGSPHNDSSSPHSDPSRSIVPTGIFVPASHVINGLPQPARQKGRP 331
            |.|:|....|     |.|......:.|.::|......|:.|          :.|:..|.:..|. 
  Fly   161 TPSASEDVDYLDVYSPQSQTQKLKNGDFATPPPTTPTSLPP----------LEGISTPPQSPGE- 214

  Fly   332 RKRKPKDIEAFTANIDLNTEYVDFGRG----SHL-----SSSSRTKRMRTSFKHHQLRTMKSYFA 387
                 |...|.:..|:........|.|    ||:     |....:||.|.::..:|...::..|.
  Fly   215 -----KSSSAVSQEINHRIVTAPNGAGDFNWSHIEETLASDCKDSKRTRQTYTRYQTLELEKEFH 274

  Fly   388 INHNPDAKDLKQLSQKTGLPKRVLQVWFQNARAKWRRMMMKQDGSGLLEKGEGALDLDSISVHSP 452
            .|.....:....::....|.:|.:::||||     |||..|:|.:           |||    ||
  Fly   275 FNRYITRRRRIDIANALSLSERQIKIWFQN-----RRMKSKKDRT-----------LDS----SP 319

  Fly   453 TSFILGGPNSTPPL 466
            .....|.....|||
  Fly   320 EHCGAGYTAMLPPL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
apNP_724428.1 LIM1_Lhx2_Lhx9 148..201 CDD:188755
LIM2_Lhx2_Lhx9 206..264 CDD:188763
Homeodomain 368..424 CDD:459649 12/55 (22%)
ftzNP_477498.1 FTZ 1..248 CDD:397787 20/102 (20%)
Homeodomain 255..311 CDD:459649 15/60 (25%)
KLF1_2_4_N <321..404 CDD:425360 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.