DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ap and Pph13

DIOPT Version :10

Sequence 1:NP_724428.1 Gene:ap / 35509 FlyBaseID:FBgn0267978 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster


Alignment Length:113 Identity:42/113 - (37%)
Similarity:58/113 - (51%) Gaps:20/113 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 RTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLSQKTGLPKRVLQVWFQNARAKWRRMMMKQD 430
            :.:|.||:|...||:.::..|...|.||....::|:.:..|.:..:||||||.|||||    ||:
  Fly     9 KQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR----KQE 69

  Fly   431 GSGLL--EKGEGALDLDSISVHSPTSFILGGPNS-----------TPP 465
            ..|.|  :..|||||||   |....|.:||..:|           |||
  Fly    70 KIGGLGGDYKEGALDLD---VSYDDSAVLGQLDSALGGGGTLLPDTPP 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
apNP_724428.1 LIM1_Lhx2_Lhx9 148..201 CDD:188755
LIM2_Lhx2_Lhx9 206..264 CDD:188763
Homeodomain 368..424 CDD:459649 22/55 (40%)
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 23/59 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.