DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ap and Bx

DIOPT Version :9

Sequence 1:NP_724428.1 Gene:ap / 35509 FlyBaseID:FBgn0267978 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001259687.1 Gene:Bx / 32846 FlyBaseID:FBgn0265598 Length:424 Species:Drosophila melanogaster


Alignment Length:151 Identity:56/151 - (37%)
Similarity:78/151 - (51%) Gaps:13/151 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 CSGCGRQIQDRFYLSAVEKRWHASCLQCYACRQPL-ERESSCYSRDGNIYCKNDYYSFFG-TRRC 210
            |:|||:.||||:.|.|::..||..||:|..|...| |..|:.|::...:.||.||...|| |..|
  Fly    92 CAGCGKHIQDRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLFGNTGYC 156

  Fly   211 SRCLASISSNELVMRARNLVFHVNCFCCTVCHTPLTKGDQYGIIDALIYCRTHYSIAREGDTASS 275
            :.|...|.:.|:|||||..|:|:.||.|..|:.....||::.:.:..|.|...|    |.....:
  Fly   157 AACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLCENKILCEYDY----EERLVFA 217

  Fly   276 SMSATYPY------SAQFGSP 290
            || |.:|.      |...|||
  Fly   218 SM-ANHPMLKRHVSSLGQGSP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
apNP_724428.1 LIM1_Lhx2_Lhx9 148..201 CDD:188755 22/53 (42%)
LIM2_Lhx2_Lhx9 206..264 CDD:188763 21/58 (36%)
Homeobox 371..424 CDD:395001
BxNP_001259687.1 LIM1_LMO1_LMO3 92..146 CDD:188774 22/53 (42%)
LIM2_dLMO 156..210 CDD:188776 19/53 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.