DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ap and CG11294

DIOPT Version :10

Sequence 1:NP_724428.1 Gene:ap / 35509 FlyBaseID:FBgn0267978 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_572500.1 Gene:CG11294 / 31807 FlyBaseID:FBgn0030058 Length:261 Species:Drosophila melanogaster


Alignment Length:145 Identity:46/145 - (31%)
Similarity:67/145 - (46%) Gaps:37/145 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 DLNTEYVDFGRGSHLSSSSRTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLSQKTGLPKRVL 411
            ||.|||: |||       .|.:|.||:|...||:.:::.|...|.||....::::.:..|.:..:
  Fly    12 DLLTEYM-FGR-------RRQRRNRTTFTPQQLQELEALFQKTHYPDVFLREEVALRISLSEARV 68

  Fly   412 QVWFQNARAKWR---RMMMKQD---------------GSGLLEKGEG-----------ALDLDSI 447
            ||||||.|||||   |:.:.||               |.|.::.|.|           ..:|.|.
  Fly    69 QVWFQNRRAKWRKQARLQLLQDAWRMRCLSLGTPPVMGGGAVQGGSGNGATARPPSQTPENLSSA 133

  Fly   448 SVHSPTSFILGGPNS 462
            |..|..:.:..||||
  Fly   134 SKDSELAEVGNGPNS 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
apNP_724428.1 LIM1_Lhx2_Lhx9 148..201 CDD:188755
LIM2_Lhx2_Lhx9 206..264 CDD:188763
Homeodomain 368..424 CDD:459649 22/58 (38%)
CG11294NP_572500.1 Homeodomain 29..81 CDD:459649 19/51 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.