DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG34409

DIOPT Version :10

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:117 Identity:34/117 - (29%)
Similarity:58/117 - (49%) Gaps:13/117 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 ANFAEIPWQAMIL---RESSK-TLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNE 489
            |:..:.||...|.   |.||: :..|.|::|....::::|.||..| |:|:.:  ....|||.:.
  Fly   256 ASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNL-VSDLEL--SHVRLGSQDG 317

  Fly   490 PLPFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDP 541
            ..||   .::.|.|||:||....::|:|::|:.   .......|||:....|
  Fly   318 ATPF---AIEQVIVHPNYDQPKYANDIALLRIN---STNGTFTPICLPFNGP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 Atrophin-1 <63..>338 CDD:460830
CLIP_SPH_Scar 343..408 CDD:465747
Tryp_SPc 428..616 CDD:238113 34/117 (29%)
CG34409NP_001097728.2 Tryp_SPc 252..501 CDD:238113 34/117 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.