DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG34409

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:117 Identity:34/117 - (29%)
Similarity:58/117 - (49%) Gaps:13/117 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 ANFAEIPWQAMIL---RESSK-TLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNE 489
            |:..:.||...|.   |.||: :..|.|::|....::::|.||..| |:|:.:  ....|||.:.
  Fly   256 ASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNL-VSDLEL--SHVRLGSQDG 317

  Fly   490 PLPFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDP 541
            ..||   .::.|.|||:||....::|:|::|:.   .......|||:....|
  Fly   318 ATPF---AIEQVIVHPNYDQPKYANDIALLRIN---STNGTFTPICLPFNGP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 34/117 (29%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 34/117 (29%)
Tryp_SPc 252..501 CDD:238113 34/117 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.