DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG34171

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:235 Identity:59/235 - (25%)
Similarity:100/235 - (42%) Gaps:41/235 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   450 CGGAIIGDQFVLSSASCV---NGLPVTDIRVKAGEW-ELGSTNEPLPFQLTGVKTVDVHPDYDPS 510
            |.|.|:.::.||:||.|:   ||:.::..|:..... .|..|.|...| :..:..:.:||.|  .
  Fly    57 CTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEF-VVDIHNMIIHPYY--H 118

  Fly   511 TNSH-DLAIIRLERRLEF-ASHIQPICISDEDPKDSEQCFTSG---------WGK--QALSIHEE 562
            .|.| |:|||:|:|.::. ..|:.|:.:.:...:....|.|.|         :|.  ..|.::.|
  Fly   119 RNQHNDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLLVNVE 183

  Fly   563 ----GALMHVTDTLPQARSECSADSSSVC-SATKFDSCQFDVGSALACGSGSSVRLKGIFAGENS 622
                ...:.|..:|..||.|   :...:| .:|:...|..|.|..|.|..    :|.||..|..:
  Fly   184 LRPFDECLKVKKSLMAARPE---NEDLICVKSTEKQMCTTDFGGPLFCDG----QLYGIALGSIN 241

  Fly   623 CGEGQTVRFAKPDI----KWINTAFAE---NNKPLLLKRF 655
            |.....|.|:  |:    .|:....:|   :.:|.:..||
  Fly   242 CSSPDPVFFS--DVSFYNSWVTKIISEAVDHTRPFIADRF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 47/187 (25%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 54/214 (25%)
Tryp_SPc 38..263 CDD:304450 55/217 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435414
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.