DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and Jon99Fii

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:278 Identity:65/278 - (23%)
Similarity:103/278 - (37%) Gaps:61/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 VNLAGVCATRNKRTKPTGVKDL----------DANFAEIPWQAMILRESSKTLICGGAIIGDQFV 460
            |..|....|..::..||.|||:          .|...::|:...:|...:....|||:|||:.:|
  Fly    11 VAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWV 75

  Fly   461 LSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQLTGVKTVDVHPDYDPSTNSHDLAIIR----- 520
            |::|.|.||.....|...|     ...|:|......|......|..|:.....:|:::||     
  Fly    76 LTAAHCTNGASGVTINYGA-----SLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTPHVD 135

  Fly   521 ---LERRLEFASHIQPICISDEDPKDSEQCF------TSGWGKQALSIHEEGAL---MHVTDTLP 573
               |..::|..|:           .|..|.:      .||||    ..::...|   :...|...
  Fly   136 FWHLVNKVELPSY-----------NDRYQDYAGWWAVASGWG----GTYDGSPLPDWLQAVDVQI 185

  Fly   574 QARSECSAD----SSSVCSATK--FDSCQFDVGSALACGSGSSVRLKGI--FAGENSCGEGQTVR 630
            .::|:||..    .:.:|..|.  ..:|..|.|..|....|:  ||.|:  |.....|..|....
  Fly   186 MSQSDCSRSWSLHDNMICINTNGGKSTCGGDSGGPLVTHEGN--RLVGVTSFVSSAGCQSGAPAV 248

  Fly   631 FAKPD--IKWI--NTAFA 644
            |::..  :.||  ||..:
  Fly   249 FSRVTGYLDWIRDNTGIS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 48/210 (23%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 53/243 (22%)
Tryp_SPc 38..262 CDD:238113 55/245 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435394
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.