DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG9737

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:428 Identity:102/428 - (23%)
Similarity:158/428 - (36%) Gaps:128/428 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 RRPTNEYLPPAAANEIPRFEPDRAPQPSNQKPIYRGEDQLSPQIFPTPQPANVPKHFAKCASALV 349
            |..||  ||....|.:.:.:.:...|.|..:..|                           .:||
  Fly    52 RNATN--LPAEKVNFLKKVQCEVEQQVSEAQGSY---------------------------ESLV 87

  Fly   350 CTSENFCNAIGVLSETPV-ELSPME--------AAF-RVPLTDCLQTENGSPGKCCRDPNYVDPW 404
            |     |.|.|.....|| :.|..|        |.| |..|...:||...|.|            
  Fly    88 C-----CPANGQDYLFPVLQFSKFEYRRFLDVTARFKRKKLKRRIQTVEPSSG------------ 135

  Fly   405 PVNLAGVCATR-NKRTKPTGVKDLDANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCVN 468
             .||...|..: ..|.....:.:||    |.||.|::: .:|....|.||:|.|:.:|::|.||.
  Fly   136 -FNLLNECGKQVTNRIYGGEIAELD----EFPWLALLV-YNSNDYGCSGALIDDRHILTAAHCVQ 194

  Fly   469 GLPVTDIR----VKAGEWELGSTNEPL--PFQLT--------GVKTVDVHPDYDPSTN--SHDLA 517
            |..|.|.:    |:.||:.:.:..:.:  |..|:        ..:.:.|||:|...:|  .:|:|
  Fly   195 GEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIA 259

  Fly   518 IIRLERRLEFASHIQPICISDEDPKDSE-------QCFT-SGWG------KQALSIHEEGALMHV 568
            ||||:..:.|...:.|||:    |..||       |.|: ||||      |..::||..   :.:
  Fly   260 IIRLKHPVSFTHFVMPICL----PNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSP---IKL 317

  Fly   569 TDTLPQARSE-CS---------ADSSSVCSATKF--DSCQFDVGSALACGSGSSVR--LKGIFA- 618
            ...:|...:| |:         .....:|:..:|  |:|..|.|..|........|  ..|:.: 
  Fly   318 KLRIPYVSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSY 382

  Fly   619 GENSCGEGQTVRFAKPDI--------KWINTAFAENNK 648
            |...||..     .||.:        .||::...:..|
  Fly   383 GFTQCGMA-----GKPAVYTNVAEYTDWIDSVVQQRKK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908 9/48 (19%)
Tryp_SPc 428..616 CDD:238113 61/231 (26%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855 12/70 (17%)
Tryp_SPc 149..406 CDD:214473 69/273 (25%)
Tryp_SPc 150..409 CDD:238113 70/275 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.