DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and Jon99Ci

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:268 Identity:61/268 - (22%)
Similarity:103/268 - (38%) Gaps:54/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 GVCATRNKRTKPTGVKDLD---------------ANFAEIPW-QAMILRESSKTLICGGAIIGDQ 458
            |||:...........:||:               |:..::|: ..:.|..:.....|||:|||..
  Fly    13 GVCSALTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHT 77

  Fly   459 FVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQLTGVKTVDVHPDY---DPSTNSHDLAIIR 520
            :||::|.|..|.....:...|..:     |||........:....:|.|   |     ||||:|:
  Fly    78 WVLTAAHCTAGADEASLYYGAVNY-----NEPAFRHTVSSENFIRYPHYVGLD-----HDLALIK 132

  Fly   521 LERRLEFASHIQPICISDEDPK----DSEQCFTSGWGK--QALSIHEEGALMHVTDTLPQARSEC 579
            .. .::|.|.:..|.:...|.:    ::.....:|||.  ...::.|:   :.|.|....:.:||
  Fly   133 TP-HVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVED---LRVVDLKVISVAEC 193

  Fly   580 -------SADSSSVCSATKFD--SCQFDVGSALACGSGSSVRLKGI--FAGENSCGEGQTVRFAK 633
                   :|..:::|..|...  :||.|.|..|....|.  :|.||  |.....|..|....|.:
  Fly   194 QAYYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGD--KLIGITSFVSAYGCQVGGPAGFTR 256

  Fly   634 PD--IKWI 639
            ..  ::||
  Fly   257 VTKYLEWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 48/221 (22%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 54/239 (23%)
Tryp_SPc 41..266 CDD:238113 56/240 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435398
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.