DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and Jon99Cii

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:259 Identity:58/259 - (22%)
Similarity:101/259 - (38%) Gaps:47/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 KRTKPTGVKDLDANF--------AEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVT 473
            ::..||.:||:....        .::|:...:|...:....|||:|||:.:||::|.|.||....
  Fly    22 QKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGV 86

  Fly   474 DIRVKAGEWELGSTNEPLPFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISD 538
            .|...|     ....:|......|...:..|..|:.....:|:::||.. .::|.|.:..:    
  Fly    87 TINYGA-----SIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIRTP-HVDFWSLVNKV---- 141

  Fly   539 EDPKDSEQ--------CFTSGWGKQALSIHEEGAL---MHVTDTLPQARSEC----SADSSSVCS 588
            |.|..:::        ...||||    ..::...|   :...|....::|:|    |...:.:|.
  Fly   142 ELPSYNDRYQDYAGWWAVASGWG----GTYDGSPLPDWLQSVDVQIISQSDCSRTWSLHDNMICI 202

  Fly   589 ATK--FDSCQFDVGSALACGSGSSVRLKGI--FAGENSCGEGQTVRFAKPD--IKWI--NTAFA 644
            .|.  ..:|..|.|..|....|:  ||.|:  |.....|..|....|::..  :.||  ||..:
  Fly   203 NTDGGKSTCGGDSGGPLVTHDGN--RLVGVTSFGSAAGCQSGAPAVFSRVTGYLDWIRDNTGIS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 45/212 (21%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 52/239 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435395
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.