DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG11842

DIOPT Version :10

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:192 Identity:44/192 - (22%)
Similarity:80/192 - (41%) Gaps:37/192 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   428 DANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRV-KAGEWELGSTNEPL 491
            |.| .|:.|            .|||.:|.|:.||::|.| :..|...:.: :.|:.|..:.|:..
  Fly    94 DEN-GEVEW------------FCGGTLISDRHVLTAAHC-HYSPQGSVNIARLGDLEFDTNNDDA 144

  Fly   492 PFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDPKDSEQCFTSGWGK-- 554
            ..:...||....||::......:|::::||.|.:.|..:..|.|:..:|.:........|||:  
  Fly   145 DPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGRLGTSFIAIGWGQLE 209

  Fly   555 ----------QALSIHEEGALMHVT----DTLPQARSECSADSSSVC--SATKFDSCQFDVG 600
                      |.:.::..|....:|    |.||:..:.    ::.:|  |....|:|..|.|
  Fly   210 IVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNA----TTQLCIGSNEHKDTCNGDSG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 Atrophin-1 <63..>338 CDD:460830
CLIP_SPH_Scar 343..408 CDD:465747
Tryp_SPc 428..616 CDD:238113 44/192 (23%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 44/192 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.