DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG11841

DIOPT Version :10

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:278 Identity:65/278 - (23%)
Similarity:103/278 - (37%) Gaps:74/278 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   419 TKPTGVKDLDANFAEIPWQAMILRESSKTLI---CGGAIIGDQFVLSSASC-------VNGLPVT 473
            ::|..|....|...|.|:.|.:....:...|   |||.:|.::.||::|.|       ||     
  Fly    68 SRPLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVN----- 127

  Fly   474 DIRVKAGEWELGSTN---EPLPFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPIC 535
              .|:.||.|..:..   ||..|   ||..:..||.::.....:|:.|::|:|.::|..:..|.|
  Fly   128 --VVRLGELEFDTDTDDAEPEDF---GVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPAC 187

  Fly   536 ISDEDPKDSEQCFTSGWGKQALSIHEEGALMHV---------------TDTLPQARSECSADSSS 585
            :..:|.:..|.....|||::..:..|...|:.|               .|.||....    ..|.
  Fly   188 LPFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYE----PKSQ 248

  Fly   586 VC--SATKFDSCQFDVGSA-------LACGSGSSVRLKGIFAGENSCGEGQTVRFAKPDI----- 636
            :|  |....|:|..|.|..       |||    ...:.||.:...:|        :.|||     
  Fly   249 LCIGSRDNKDTCNGDSGGPVLAYHKDLAC----MYHVMGITSAGITC--------STPDIPSAYT 301

  Fly   637 ------KWINTAFAENNK 648
                  .||....|:..:
  Fly   302 RVHYFLNWIKGELAKQTQ 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 Atrophin-1 <63..>338 CDD:460830
CLIP_SPH_Scar 343..408 CDD:465747
Tryp_SPc 428..616 CDD:238113 54/224 (24%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 62/264 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.