DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG4815

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:216 Identity:42/216 - (19%)
Similarity:81/216 - (37%) Gaps:48/216 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   444 SSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRV---KAGEWELGSTNEPLPFQLTGVKTVDVHP 505
            :.:.|:|...::..:.:|::|.|...|..:...|   |:.|:.....|    |....:..|.:||
  Fly    55 NGRKLVCSATLLTPRHILTAAHCFENLNRSKFHVIGGKSAEFTWHGNN----FNKNKLIRVQIHP 115

  Fly   506 DYDPSTNSHDLAIIRLE--RRLEFASHIQPICISDEDPKDSEQCFTSGWG----------KQALS 558
            .|.......|:|:.:.:  .|.::..:.| :|.|...|:|  :...:|||          |:...
  Fly   116 KYAKMKFIADVAVAKTKYPLRSKYIGYAQ-LCRSVLHPRD--KLIAAGWGFEGGVWDESRKKTFR 177

  Fly   559 IHEEGALMHVTDTLPQARSECSAD------SSSVCSATKFDS--CQFDVGSALACGSGSSVRLKG 615
            ..:.|.:         ::.:|...      .:.:|:....:.  |..|.|..|..|.    ::.|
  Fly   178 SMKVGIV---------SKRDCEKQLDRKMPPNIICAGAYNNKTLCFGDSGGPLLLGR----QVCG 229

  Fly   616 IFAGENSCGEGQTVRFAKPDI 636
            |......||..:     |||:
  Fly   230 INTWTFKCGNNE-----KPDV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 35/194 (18%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 42/216 (19%)
Trypsin 49..256 CDD:278516 42/216 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435413
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.