DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG16710

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:376 Identity:93/376 - (24%)
Similarity:152/376 - (40%) Gaps:112/376 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 PANVPKHFAKCASALVCTS-------ENFCNAIGVLSETPVELSPMEAAFRVPLTDCLQTENGSP 391
            |.|:.:   ||.|...|||       .|.         ||.|.:..|..:      |   ..|..
  Fly    29 PCNLDE---KCISLARCTSLLPFLKPHNM---------TPAEKAVFEDRY------C---GYGPK 72

  Fly   392 GK--------CCRDPNYVDPWPVNLAGVCATRNKRTKPTGVKDLDANFAEIPWQAMIL---RESS 445
            |:        ||.:..::.|    ...:|.......:..|.::...|  |:||.|:||   |..|
  Fly    73 GQELLDRVLICCPNMGHILP----NTQICGPIMPAYRIFGGEETQPN--ELPWMALILYAHRSRS 131

  Fly   446 ---KTLI--CGGAIIGDQFVLSSASC--VNGLPVTDIRVKAGEWELGSTNEPLPFQLTGVK---- 499
               :.|:  |.|::|.:::||::|.|  :.||.:.  ||:.||..:.| |......:.|.:    
  Fly   132 VWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLR--RVRLGEHNILS-NPDCVTHINGREHCAP 193

  Fly   500 ---TVDV-----HPDY--DPSTNSHDLAIIRLERRLEFASHIQPICISDE----DPK-DSEQCFT 549
               .:||     |..|  ......:|:|::||:..:.:.:.|:|||:..:    :|. .:.:...
  Fly   194 EHLEIDVDLSIKHRHYMVFEERPYNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQI 258

  Fly   550 SGWGKQALSIHEEGALMHVTDTLPQA------RSECSADSSS--------VCSAT--KFDSCQFD 598
            :|||   || |::|    .::.|.||      ..|||....|        :|:..  ..|:|:.|
  Fly   259 AGWG---LS-HKQG----YSNVLLQAYVNGRNADECSLSEPSLGLDKETHICAGNLGGNDTCKGD 315

  Fly   599 VGSALAC----GSGSSVRLKGIFA-GENSCGEG-----QTVRFAKPDIKWI 639
            .|..|..    |....|.|.||.: |.:.||.|     :|.:|    ::||
  Fly   316 SGGPLMAIMERGDEEFVYLAGITSYGYSQCGYGPAAYTKTSKF----VEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908 93/376 (25%)
Tryp_SPc 428..616 CDD:238113 62/236 (26%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 14/66 (21%)
Tryp_SPc 105..362 CDD:214473 71/273 (26%)
Tryp_SPc 106..362 CDD:238113 71/272 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435489
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.