DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scaf and CG5255

DIOPT Version :9

Sequence 1:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:191 Identity:41/191 - (21%)
Similarity:73/191 - (38%) Gaps:31/191 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   418 RTKPTGVKDLDANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEW 482
            :.:..|.::..|..|  |:|..:....|....||||||.:::::::|.|..|...|..||..|..
  Fly    27 KNRIVGGEEAAAGLA--PYQISLQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQ 89

  Fly   483 ELGSTNEPLPFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDPKDSEQC 547
            :|........:.    ..:..|.:|.|....:|:|::.|...:.|.:..||:.:..|......:.
  Fly    90 DLHQNGSKYYYP----DRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALVPGSRL 150

  Fly   548 FTSGWG----------------------KQALSIHEEGA---LMHVTDTLPQARSECSADS 583
            ..:|||                      :|..:.|:...   :.||.....:.|..|..||
  Fly   151 LLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 40/181 (22%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 41/189 (22%)
Tryp_SPc 30..252 CDD:238113 41/188 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435561
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.